CAZyme Information: OAG14654.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14654.1
• CAZy Family: AA7
• CAZyme Description: galactose oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	KV441498|CGC2	93328.63	4.4742

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441498:57814-60473(-)

Full Sequence      

MGVAGAMTNAKCRDACRAGGYVLAGTEYAGECFCDNQIRNNGGPAPDGEVGCNMACNGDQ
TEMCGGPDRLTFFRFYTGGESTVSATASPTASQTASATKTSSALPVATGLPDGFEYKGCY
VDGPGFRIVNYQQPDDQSMTIASCSNACAKAGYEIAAMEYSYQCFCDNTVRMGGKPASSE
SECNTKCAGNQDETCGGPNRMSIYSSQDPLKVINAPAPIQNVSDWQYQGCITDTNNQVFP
WKLVNQTGNSPQWCLSQCQAFGYQAAGMEYGEECYCGDLDGIEKSGSKTVAESECNTACP
GNPEALCGQGNRLSWYKWEGDPLYVWEYPKGIAAGRYDFLVGGPIIPLISQPGVNGKVSL
LEKHGTGEPNTTGAYEFDPSIGGDIFHAFRELSGIKTDIFCAAGLTMPDRAGRQINIGGW
STDSLFGVRIYWPDGSAGVNGTNDWQEDVNSVKLQRGRWYPTGMVMANGSMLIVGGQDGS
NGPPVPNMEILPTVGPVYEAQYLRDTDPYNLYPFLVVLPSGGIFIQYYNEARILDEVSLD
TVKILPKAPAAVNDPTGGRTYPYEGTQVLMPQYYPYDAPLEVLICGGAARQPKWGLDNCV
SIEPDVANPEWTLERMPSRRVISCMATLPDGTYLILNGAEVGEAGFGLADQSNLNAVLYD
SRKPRHQRMSIMANTTIARMYHSEAVVMDDGRILVSGSDPQDEGKHPQEHRIEVFLPPYL
LSGPAQPTFELLQNDWIWEEDYSFTVTSSSGGPIKVSLLGSESSTHGSSMGARILFPSVS
CSGGACTVKAPKGPYVAPVGWYRMFVLDGPTPSHAKWVRLGGDPAALGNWPDAAAFQPLP
GMGPVGVSSKSIANATVPRSMSTVARSFQG

Enzyme Prediction     

No EC number prediction in OAG14654.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	329	843	1e-137	0.3832943013270882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401164	DUF1929	4.20e-25	743	820	11	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
399910	Glyoxal_oxid_N	5.23e-25	376	587	50	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
396406	WSC	1.68e-22	118	197	2	80	WSC domain. This domain may be involved in carbohydrate binding.
199882	E_set_GO_C	6.11e-20	721	820	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
214616	WSC	1.03e-19	113	207	1	95	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7192970.1|AA5	0.0	1	870	50	923
QRD01892.1|AA5_1	0.0	3	860	194	1062
QUC17769.1|AA5_1	0.0	7	838	305	1131
QLI73916.1|AA5_1	0.0	6	838	302	1127
UNI14602.1|AA5_1	0.0	7	836	178	1119

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	1.56e-20	454	820	253	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
5LXZ_B	7.53e-19	454	820	242	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	7.64e-19	454	820	247	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
5FWW_B	1.44e-07	118	206	92	180	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	2.21e-07	118	206	101	189	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AUF1|WSCD1_ARTBC	0.0	1	842	85	924	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q3HRQ2|GLOX_VITPS	1.59e-51	395	820	91	521	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	2.48e-46	389	820	139	593	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1
sp|Q9FYG4|GLOX1_ARATH	6.81e-45	458	820	225	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q01772|GLOX_PHACH	2.31e-32	390	824	82	554	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984217	0.015808

TMHMM  Annotations     

There is no transmembrane helices in OAG14654.1.