CAZyme Information: OAG14470.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14470.1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353		39463.72	8.8574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441500:259926-261038(-)

Full Sequence      

MRFSSIVASLALAGSAVASPTYGHGKDNDSLYKSMKKAGRSFIGTALTLRNETREGEIIK
ADFNSFTPENAMKWESVEPSRNNFTFEDADRYAAYAKKNNLQIHCHTLVWHSQLPPWVSE
GGFDNKTLIGIMENHIKTVMTRYKSVCTRWDVVNEALNENGTYRSSVWYDTIGEAFLPIA
FRFANKYRGKAELFYNDYNLEYNAEKTQGAQRIVKLIKSYGVRIDGVGYQAHLASEATPT
APGAAPDQKTLEAALRATADLGVDVVYTEIDLRMNTPATAEKLKVQADAYERVAKSCLAV
KRCIGMTVWGISDKYSWIPGVFPSEGAALLWDDNYEKKPAYKGFLKGIQSKKH

Enzyme Prediction     

EC	3.2.1.8:2	3.2.1.4:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	31	346	2.2e-100	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	3.13e-135	31	346	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	3.70e-112	72	344	1	263	Glycosyl hydrolase family 10.
226217	XynA	8.15e-93	3	342	2	335	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7194426.1|GH10	1.96e-207	1	352	1	353
CBX90572.1|GH10	4.44e-206	1	353	1	349
QOG93855.1|GH10	3.07e-178	1	352	1	351
AQX83205.1|GH10	4.76e-168	1	352	1	352
QRC96891.1|GH10	1.18e-159	1	349	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U7B_A	7.43e-136	31	348	5	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
6JDT_A	1.54e-103	31	348	3	317	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	4.82e-94	61	348	59	339	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	7.80e-81	52	341	27	305	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	1.99e-78	52	341	27	305	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2PGV8|XYN2_AURPU	5.39e-160	1	350	1	357	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	3.82e-135	31	348	5	324	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|I1RQU5|XYN1_GIBZE	1.83e-132	26	350	16	342	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|Q5ZNB1|XYND_TALFU	1.25e-96	31	350	21	336	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|O60206|XLNA_AGABI	7.11e-86	37	347	25	330	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000332	0.999618	CS pos: 18-19. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in OAG14470.1.