CAZyme Information: OAG14403.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14403.1
• CAZy Family: AA5
• CAZyme Description: beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	KV441500|CGC3	92581.94	6.1571

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441500:97503-100142(-)

Full Sequence      

MTLSNDENTSQEHAASFAPFDVEEALLQLTIDEKVSLLSGKDFWHTRDIPRLSIPSIRLS
DGPNGIRGTKFFGSVPSACLPCGTAIGATFDSDLVVEIGHLLGDEARAKGAHVVLGPTIN
IQRGPLGGRGFESYSEDPYLSGKLAASYINGLKDKHIGAAIKHLVCNDQEHERMAVNTIV
TQRALREIYLLPFMLATRLSNPEAIMTAYNRVNGVHVAEDRSILKDILRKEWRWDGLFVS
DWFGTYSTSEAINAGLDLEMPGPSRWRGPALVHAVSANKVLPSKLDERVRAVLKLVKKSA
QSGIPENAPETQLNRPADRSLLRKVAADSIVLLKNQDNILPFSCDRKIAVIGPNAKIATY
CGGGSASLNAYYTTTPLDGIRSLAKGGVDFAQGAYAFQMLPELGKELTVDGKPGFKLRFF
NDPPTNVERTPLEERILTDSNIFFLDYDHPNLKEIWYAETEGVFAPTQSGTYDFGLCVHG
TGRLYIDDELLVSNVEHQRPGPSFLGSGTLEETGSKVLIAGRAYRITVQWGCAKTSTRKT
PGTVDFGHGGLRFGGCLRQDPQELIDTAVRLACEVDQVVICVGLGPEWESEGDDRVSMDL
PPNTDTLVERVLEANSNAAIVVQSGTPVAMPWSDKAKAILHAWYGGNEGGNGIADVLFGA
VNPSGKLPLTFPRRLKDNPTYLNYRSEGGRVLYGEDVYVGYRFYEQTEVAPLFPFGHGLS
YTTFALSNLKLDMNTQTDRLSVRCTVSNTGSRAGAEVVQVYIEPISPPIRRPLKELKGFA
KRHIEAGQSAEVIVEIDVLRDTSFWEEKEGRWCSHAGMYNVLVGTSSAGCHLSGSIVSPK
ARYWLS

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	48	261	1.1e-61	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.71e-83	51	828	101	755	beta-glucosidase BglX.
224389	BglX	4.08e-64	41	388	47	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	7.51e-58	330	721	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	6.36e-41	29	824	60	769	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.04e-37	80	295	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	0.0	21	844	21	843
BCS00565.1|GH3	0.0	21	844	21	843
QQK47512.1|GH3	0.0	8	844	9	845
CAK49185.1|GH3	0.0	21	844	21	843
BAE65953.1|GH3	0.0	18	844	19	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.43e-261	20	844	4	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.81e-257	20	844	4	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.91e-146	21	836	4	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.14e-125	29	827	12	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.19e-103	22	842	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	21	845	5	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	22	844	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q4WLY1|BGLJ_ASPFU	0.0	22	844	14	862	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B8NDE2|BGLI_ASPFN	0.0	21	845	5	837	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	0.0	21	845	5	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

There is no transmembrane helices in OAG14403.1.