CAZyme Information: OAG14297.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14297.1
• CAZy Family: AA3
• CAZyme Description: cellulose-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	KV441501|CGC2	26692.82	9.9653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441501:139589-140388(-)

Full Sequence      

MVKFSTLALGLLAIAGEVCAQSKVKVMPFGASIVSRCWRANLQTSLRAGGVTNFDFVGSQ
KSSCAGTDIDQDHEGHPGKQAAEFVAKGNLTVWLNQNPPDVIIMLLGTNDVIIGKRSVDD
ILASYDILIGQMRKKNPNMQIVFSNLLPLDPAKWAASAVKGIKDLNTAIATYAPKKSTTK
SPVYFVDNFSGFDPVKDADSDGEHPNLTTGVQKMAAKFLDPTKTAIRAAAALKAKRVKRA
DRMLNLSE

Enzyme Prediction     

No EC number prediction in OAG14297.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	24	220	4.4e-46	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.58e-43	24	222	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.23e-14	49	220	16	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	3.97e-12	75	206	28	153	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.33e-11	99	206	62	170	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238879	NnaC_like	1.41e-08	96	206	49	159	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7199210.1|CE3	4.06e-109	1	236	1	234
CBX93727.1|CE3	9.42e-91	1	228	1	225
QRC97238.1|CE0	6.96e-80	3	229	2	236
ARQ70539.1|CE3	2.01e-39	24	226	42	242
QOS59454.1|CBM2|CE3	2.42e-39	24	220	164	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.59e-28	24	206	2	184	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	4.41e-28	24	206	2	184	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]
2VPT_A	1.10e-10	20	204	2	178	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

OAG14297.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999771	CS pos: 20-21. Pr: 0.9788

TMHMM  Annotations     

There is no transmembrane helices in OAG14297.1.