CAZyme Information: OAG14234.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14234.1
• CAZy Family: AA3
• CAZyme Description: putative alpha-L-rhamnosidase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	KV441502|CGC2	84786.08	4.3123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441502:270142-272606(-)

Full Sequence      

MRLFALGLALNVLAGLDPSSAEGLASDATTIILGSNGTITLKGNSSTSEVILDYGANVEG
FPTFEIISVSGDTSGLQITYSESLAVLLSSPTSDGPLGLAAAMDTYRINNYNITEPTNKT
NRLIQGGFRYQKLALLTPGDMVLAKVGVKPSISTTPIASLPGSFQCSDDRINQIWNVGAR
TVQMNEIPARSIPDFWEVSSEGSLVHSLAPQSLSGVVASSLMDYEIEFDVKPIAGGFSFS
ALASTLNDGVYIWCNIANGSISANSGSSESADFLAFATLPSNITVGNWYHVKAAISAELI
SIYFGSTKVLEFSQTYAFFGSSGLGAALGQSAMFRNFTLASPAVNFEYSAQLTDTSFLPD
FLMGTNPLAAAVDGSKRDRISYAGDLDVAVGSTMVSTVGVEYIMGTLELLGSSQMTPGFF
SPTAKIQQEPYSKPLESNITGLIGYSFNMVTAVANFYQYTGNTSIAKEWAPKVVRMLDWA
DSQVLPSNGLFNISNPAFSGDWNYYDPAQSGVVTKFNMVYAYALQSSLTMLDDAGVNTTT
YRSRLDALRVAINTHLWNSEPGAFYISEALTDSFGQDSNALAILAGVTNSNHTSSQVLST
LSELSTPSGPLAFSNGTVAAGFRKLISPYASAYHLRAAFAAGDATVANELLHSLWYPMAD
PAGANYTGCFWETLDANGGPGLGAITSLCHAWASGPTGELSTYILGATATKPGFREWQVS
PMTLGLSWAAGTIPVPDGGVYVAWNATEGQITHLEIESPANTKGVVSLPVCGDGSTWKLN
GQAISTSNGTFTVNGGQNLVFSLS

Enzyme Prediction     

No EC number prediction in OAG14234.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	369	768	1.7e-68	0.7301587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.01e-10	440	692	94	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	2.44e-07	711	770	6	65	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ58110.1|GH78	0.0	31	797	38	802
UKZ83809.1|GH78	0.0	26	797	2	770
UQC81548.1|GH78	8.26e-289	30	800	46	817
QMW34696.1|GH78	3.22e-288	25	797	37	810
QMW46762.1|GH78	6.47e-288	25	797	37	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.04e-17	372	779	331	717	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.99e-16	445	769	629	942	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

OAG14234.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999685	CS pos: 21-22. Pr: 0.9712

TMHMM  Annotations     

There is no transmembrane helices in OAG14234.1.