CAZyme Information: OAG14218.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14218.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	KV441502|CGC1	37097.27	4.5185

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441502:244691-245662(+)

Full Sequence      

MLSRSLQLPKALNYYLFIAICTIVLVYYFLFVQARFIIRAPGAPAIAQQPQPNSIPKLIW
YKLGPNGLSEETQAWTDSCVKNNPDYEARFLTEDDGDDYIRKTFVESRPDIVDTYLALPI
PIYKADFLRYVLLWNEGGVWSDLDVSCEEDVRIDEWVPEIYKDKAALVVGWEFDQGWPGR
YERQFESWTIMAKPRSPHMMQVIEDILQTLQEKTAEFDVSVNNITMDMMGDTVDFTGPRR
LTRSVYTSLGSLLNRTVDAYDMKELVRPRLVGDVLVMPGRSFAASANTYQPEEEKLLPPQ
LVTHHYAGTWKNDDGGEKVKETP

Enzyme Prediction     

No EC number prediction in OAG14218.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	158	5.1e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.24e-16	55	194	82	231	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.42e-13	77	159	9	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.003	77	159	70	146	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7026497.1|GT32	7.50e-157	1	318	1	312
CBY00800.1|GT32	5.20e-123	1	316	1	317
CAE7002672.1|GT32	2.96e-114	53	321	70	336
QQK44540.1|GT32	2.79e-105	49	317	53	317
QBZ63204.1|GT32	2.18e-96	39	319	50	326

PDB Hits     

OAG14218.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	5.35e-25	50	313	137	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	4.04e-23	56	321	100	385	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.98e-21	56	312	131	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	7.42e-13	55	323	96	387	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P38287|CSH1_YEAST	2.10e-09	52	154	59	155	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000001

TMHMM  Annotations     

Start	End
12	34