CAZyme Information: OAG14145.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14145.1
• CAZy Family: AA3
• CAZyme Description: NAD(P)-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	KV441502|CGC4	44165.35	6.4994

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441502:61534-62847(-)

Full Sequence      

MSSEPFTLRWGILGCGGIATTFTKDLLIDPRTRDAFDIRHVVVAAATSTSAQRAQDFCTN
VGVPPNTAKAYGSYKELVEDPDVDIVYVATPHSHHYQHARLVLAAGKHVLIEKPITVTAE
QCKELRKLAREKKRFMMEAVWTRFFPLSREVCSIIQSSRLGTITRVFADFSFWNDVEKEF
GKEHRMINPELAGGALLDLGIYSLTWVFMACYYCQQPGRKDGHGKTMDKKEEPVVVSAVS
KGETGVDETTTVLLHWKGTGAHAVAGTSIRVATTPNAEHVGGDAVRIQGTLGDLTVNYAP
RPRTYTLVPAANEKRGKPADFEYEVVDKFKDIPGGGHGMFWEADECARCVRDGRMESEVC
GLEETEVLMGVMDQVRKNGGILYPERISSLEYPLEGFGI

Enzyme Prediction     

No EC number prediction in OAG14145.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	7	168	2.3e-18	0.39348370927318294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	4.71e-50	7	354	3	309	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	3.94e-28	8	137	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
183212	PRK11579	3.07e-14	7	136	4	118	putative oxidoreductase; Provisional
182305	PRK10206	1.89e-13	76	176	58	158	putative oxidoreductase; Provisional
275173	myo_inos_iolG	1.16e-12	7	163	1	145	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS38310.1|GH0	1.82e-12	69	233	80	242
BDC49873.1|GH0	1.82e-12	69	233	80	242
CCO12039.2|GT4	2.09e-10	12	216	1	203
QUE50656.1|GH0	3.22e-10	8	170	39	203
QDT25536.1|GH0	1.04e-09	3	204	45	258

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	1.04e-48	8	385	3	331	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
5A02_A	1.85e-20	8	205	7	192	Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
3EVN_A	7.65e-20	8	207	6	187	CRYSTAL STRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3E9M_A	1.67e-18	8	207	6	187	Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
1OFG_A	2.75e-18	39	205	55	220	Chain A, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A024SMV2|XDH_HYPJR	1.42e-109	2	392	3	380	D-xylose 1-dehydrogenase (NADP(+)) OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyd1 PE=1 SV=1
sp|Q148L6|DHDH_BOVIN	6.78e-50	8	385	3	332	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Bos taurus OX=9913 GN=DHDH PE=2 SV=1
sp|Q9UT60|XDH_SCHPO	1.63e-48	1	384	4	360	Probable D-xylose 1-dehydrogenase (NADP(+)) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhd1 PE=3 SV=1
sp|Q9UQ10|DHDH_HUMAN	3.81e-48	8	385	3	331	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Homo sapiens OX=9606 GN=DHDH PE=1 SV=1
sp|Q9TV69|DHDH_PIG	3.91e-48	8	385	3	332	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Sus scrofa OX=9823 GN=DHDH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG14145.1.