CAZyme Information: OAG13919.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG13919.1
• CAZy Family: AA3
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A177D4M9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	KV441504|CGC1	66203.93	8.2372

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441504:30804-32636(+)

Full Sequence      

MVDEKPDFSDPDGMKVRRAQRLMKLRKLAFQCCIFGLNGFLLFGSWWFKGYHYVFLPFIT
YGVFINFTVVITLLLWLAFRFFRPEKKNPAPETPESLMLIIPCYNENEEELRKSLDSLVE
QKGIEDHKQCVFIICDGRARGPGMTQTTGECLLDTILTEKTSRIHMKDAYMAWDKEPMDI
IMQKGQYRGLNYLCIVKMTNKGKRDGLILLRSFAYKFNQRHERPTTIMSNRLFGEMTSFV
LDDCGINNFDQIVGMDADTVFDPWCIYYLISESRYPKCFGVCGVVWVDFKDGPWNMWRLM
QNASYTISQGLPRLHQSTVTHKVSCLPGCCQILKVCEENNGDHILRTLFGYCPSPTDGML
KHLRGAYSEDRNHVCHVLTASPHVQTRQSIKSVAWTDVPTSLSVFMSQRKRWSMGATVND
FRLVFAKGTQWFERLRAFSNCQTWFCNIFIMGSIAGLIHAARSVPWYITVAFLGGVIVPY
MYMLTLVFWMPKGRKAKCQFLVGLVIYFFTGPFLTILVLFYTMWHLDAFSWGKTRQVISE
DTDASGKEASSNDAVDEKAPHTVTVNDEEATIGMGR

Enzyme Prediction     

No EC number prediction in OAG13919.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	196	548	4.3e-28	0.6698292220113852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	3.62e-31	84	542	14	500	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	4.68e-21	101	419	3	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	2.32e-10	41	525	9	402	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.50e-09	99	332	1	160	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133061	CESA_like_1	0.002	69	137	3	69	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX96472.1|GT2	2.09e-308	2	576	185	748
QMW30587.1|GT2	9.53e-188	17	541	101	623
UDD59401.1|GT2	9.53e-188	17	541	101	623
SMR61951.1|GT2	2.46e-186	5	573	81	665
SMR64450.1|GT2	2.46e-186	5	573	81	665

PDB Hits     

OAG13919.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13395|CHS6_USTMA	1.77e-29	90	540	401	862	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|P30573|CHS3_CANAX	6.79e-24	100	541	667	1134	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1
sp|J9VF17|CHS4_CRYNH	1.22e-23	101	540	512	961	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|J9VNT4|CHS5_CRYNH	3.15e-22	90	540	1247	1708	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|Q4P9K9|CHS8_USTMA	5.58e-22	78	540	1251	1720	Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS8 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000002

TMHMM  Annotations     

Start	End
28	47
57	79
444	461
466	488
500	522