CAZyme Information: OAG13814.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG13814.1
• CAZy Family: PL4
• CAZyme Description: glucan 1,3-beta-glucosidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	KV441506|CGC1	33378.99	4.7241

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441506:197483-198470(-)

Full Sequence      

MWAKAVSIVALATTAVAQTKGFNYGATNADGSCRGYNDFVRFFNEAKSLPGASGFNTARL
YTSVQCGTAADPISAFQAAIDTDTQILVGLWASAGRTAYENELNALIRGARDLGSAFTDK
VIGISVGSEDLYRSSPQGVQNNAGVGATGTEIEGYIGWMRDWLRGTSLEGKPIGHVDTWT
AWVLPENRGVANTVDWLGHNSFPYFETTKPNSIDQARENFFAAVGQTEGVSGGKPVWVTE
TGWPRIGPNSGAAVASLENSKRYWDEVGCSLFGTRNTFWYTLKDANAAQTDLSFAITPKE
NNTPFFDLTC

Enzyme Prediction     

No EC number prediction in OAG13814.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.89e-25	19	273	45	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.003	180	286	154	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX92291.1|GH17	1.15e-207	1	310	1	310
QRD07209.1|GH17	6.38e-205	1	310	1	310
AQA29328.1|GH17	1.84e-102	7	310	5	309
UJO16123.1|GH17	1.84e-102	7	310	5	309
UQC81989.1|GH17	2.13e-101	9	310	9	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	7.01e-19	21	269	39	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.68e-18	21	269	39	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ47|EGLC_NEOFI	8.75e-98	9	310	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.76e-96	9	310	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.98e-96	9	310	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	7.37e-94	14	310	15	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	6.23e-93	5	310	8	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999756	CS pos: 17-18. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in OAG13814.1.