CAZyme Information: NEUTE1DRAFT_88279-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_88279-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: pectinesterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		35535.72	8.9553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:3050806-3051894(-)

Full Sequence      

MKSLLLPLLSLLSLSSSALAATRISPPSSACLRVGAGQPYSNIQSAVNALSTTASGSQCI
FIYPGTYWEQVLIPARSAQLSIYGYTTNTLGYASNTVTIIANRSQADGLNNDQTATVRVK
SSNTRLYNLNIENAHGQGSQAVALSVAADGVGVYGCQLKGFQDTLLAEDGAQLYARTLIQ
GATDFIFGQRAPAWFEKCDIKVMAANLGYITASGRDSSSNPANYVFNSCSIAAAAGNNVP
SGAYYLGRPWRQFARVTFQKTSMTNVINPAGWQIWNNGDERTSNVEFGEYANTGAGASGT
RASFGKKLDSPVKIESVLGSRYTRQGYYDSSYM

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_88279-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	38	308	2.2e-77	0.9097222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	2.47e-49	40	297	23	260	putative pectinesterase
395871	Pectinesterase	1.43e-44	35	298	8	267	Pectinesterase.
178372	PLN02773	6.05e-44	27	297	2	270	pectinesterase
178113	PLN02497	4.15e-41	40	308	44	306	probable pectinesterase
215367	PLN02682	8.14e-41	40	308	82	347	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC59472.1|CE8	7.98e-146	16	333	11	326
QPC71066.1|CE8	1.13e-145	16	333	11	326
CEF78207.1|CE8	1.61e-145	16	333	11	326
CZS81503.1|CE8	1.61e-145	16	333	11	326
CEI61946.1|CE8	3.75e-144	16	333	11	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.26e-64	22	332	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.26e-64	22	332	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.43e-30	40	298	19	274	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	8.45e-95	17	332	14	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.20e-94	15	333	12	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	3.82e-66	23	332	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	3.02e-65	23	332	28	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.69e-64	31	332	35	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999749	CS pos: 20-21. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_88279-t26_1-p1.