CAZyme Information: NEUTE1DRAFT_80275-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_80275-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	GL891303|CGC17	45992.30	5.3914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:5006612-5007936(-)

Full Sequence      

MRFVKSVKPAAAAISLISAGIPKSLDISSPTSVQGVAKTIAQNTMSFYKGTDDQFVDLDA
PYYWWQCGAMMGSMLDYSHYTGDHTYDKKIATAIVAQAGPDFDFMSPAHAGQEGNDDQAF
WGFTVLAAAERNFPQPRSDIPGYLELGENIWKSLASRWDTSTCNGGLRWQIFASNPNGLD
YKNAVSNGGFFQLSARLARITGNQTYVEWANKVWDWTQGTGIINEYYQVLDGASSAKNCS
DVSAAHTPSFSYSQGIYTYGAAVMANISTGADQDKWTDRTKRLLESSQNYFTPFGDVKNS
TDVMYEHACEHIDICNTDMRSFKGYFSRFVYASKIMVPSIKPTVDRLLHTSAKAAAQGCQ
GGSQGTMCGTKWYVDGFYGDAGLGEQMSALETIQGILIDQANPPLKGDDIKTVRTFSSSS

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_80275-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	30	400	2.3e-92	0.9357541899441341

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.99e-159	32	390	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	1.64e-09	165	360	134	304	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28695.2|GH76	4.65e-315	1	420	1	420
CAD11780.1|GH76	2.37e-300	1	420	1	406
AEO60662.1|GH76	5.35e-202	1	420	1	411
AEO70787.1|GH76	7.74e-195	1	420	1	411
CDP24660.1|GH76	1.03e-191	1	417	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.06e-81	37	404	40	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	7.21e-103	25	408	21	399	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	4.99e-97	10	396	8	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	6.08e-97	25	404	21	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.49e-95	25	393	24	381	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.78e-91	24	398	21	385	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.880686	0.119328

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_80275-t26_1-p1.