CAZyme Information: NEUTE1DRAFT_75235-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_75235-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: chitin synthase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
888	GL891302|CGC10	100393.50	6.9505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891302:902669-905452(+)

Full Sequence      

MDPRMHTAPPAGHPIQPGYQLEDNPYHHQQGFDIPAGPGRYSPGDALHIQTPQPIEGMGG
YNAPGQHYTPDYAVNPEEHHDAYYNQPYEPQVGHDPYAAAPTPPVAGYQAHDDQRPMLMH
TDSQVGQSDPYHDEPQPPTNNAPIKRWKTVKQVLLYRGNLVLDCPIPPKLLNQLPHGERD
EFTHMRYSAATCDPSEFYEENFTLRQKLFSKPRHTELFIVVTMYNEDEILFARTMIGVFK
NIEYMCKRTESKTWGKDAWKKIVVCVVSDGRAKINPRTRALLAGMGVYQEGIAKQQVNGK
DVTAHIYEYTTQVGMTIKNDVVQLIPKQQPVQMLFCLKEKNQKKINSHRWFFQAFGRVLD
PNICVLIDAGTKPGGSSIYHLWKAFDLEPMCAGACGEIKAMLGTGGKNLINPLVATQNFE
YKMSNILDKPLESAFGFISVLPGAFSAYRYVALQNDKNGQGPLEKYFAGEKLHGGDAGIF
TANMYLAEDRILCFELVTKRNCHWILQYVKSATGETDVPADLTELILQRRRWLNGSFFAA
IYAIVHFHQFFRSDHSFLRKIAFFIEFVFQTVNMIFAWFAIGNFFLVFKILTTGLGDDKL
LGTVGEILGVVFAWAYGVTLITCFVLSMGNRPAGSPRLYMGMVVFWAIIFIYLMFAAIYI
AVVSIQTDVQKGLSFTDLFRNELFYTLIVSVVSTYGIWLIASLLMFDPWHMVTSMVQYML
LSPTYTNVLNVYAFCNTHDISWGTKGDDKPDKLPSVNTKDGQGKTDLPDEGDLNASYERE
IQVFSRKYVKPVTAPTSAQLEEKQMDYYRGVRSMVVLVWMITNFALCAVVLSTAGLERID
PEEGSQEQETTKRATIYMSVVLWSVAVLSGFKFVGACWFLVVRMFRGV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	223	385	4.7e-77	0.9938650306748467
GT2	363	574	2e-17	0.3908918406072106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.36e-110	223	385	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	2.87e-98	219	539	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	1.46e-35	152	222	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	5.09e-28	334	677	115	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.42e-14	219	453	1	166	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC28596.1|GT2	0.0	1	888	1	888
AEO63486.1|GT2	0.0	1	888	1	886
AEO56973.1|GT2	0.0	1	888	16	886
VBB76382.1|GT2	0.0	2	888	20	892
CDP26294.1|GT2	0.0	2	888	20	892

PDB Hits     

NEUTE1DRAFT_75235-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30588|CHS3_NEUCR	0.0	1	888	1	888	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30601|CHS2_EXODE	0.0	8	884	27	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30583|CHSC_EMENI	0.0	6	888	28	918	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|Q12564|CHSA_AMPQU	0.0	65	884	67	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|P30595|CHS2_RHIOL	3.64e-286	145	887	115	858	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

Start	End
532	551
572	594
607	629
642	664
684	706
814	836
860	882