CAZyme Information: NEUTE1DRAFT_68174-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_68174-t26_1-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46732.82	7.1482

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:34560-36104(+)

Full Sequence      

MVTMSTWPWGLLVTTGYLLNLTFAAHPLTTDANCHCYKTNATSTNYFRQHKFFDFRNLQQ
YANTPPNPISTFEGNAAAPPTSSYFDSNQWKDNWGIQTWNNTELMRLNNTDVNDATVPMI
NSFNNIYIERSSDRNANGQTYLVMRTVRHSLDGPSTRYGSNSSSGFQSSAEFESKLTSYQ
FLSLRMLARTRGSPGAVTAMFTYRPPPQPQQLALVQEADLEIRTQDPPNFVQYTNQPAWN
STSDIKEATRNASMPSGKKWSDWAFYRMDWTPGQSTWFVNGVEASKINFQAPRDPSQVMF
NVWSDGGSWSGIMGQGGKAEMQVQWIEMVYNSTEVSGPVTGPWGDKKGCANICSIDETTQ
LGTPVLISNPNGGNTPANPPNSCTTVKYGQCNGKNWNGCKTCASGSACRYQNDYYSQCL

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_68174-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	92	328	3e-93	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	9.73e-49	85	329	3	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395595	CBM_1	7.88e-11	387	415	1	29	Fungal cellulose binding domain.
197593	fCBD	1.93e-09	387	419	2	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
185684	GH16_lichenase	5.94e-06	262	326	139	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	4.18e-04	175	327	107	261	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO63760.1|CBM1|GH16_22	1.66e-170	10	419	11	398
AEO55749.1|GH16_22	2.35e-123	27	368	35	383
QLI63560.1|GH16_22	3.76e-97	31	362	26	350
AEO57601.1|GH16_22	2.81e-96	28	367	38	357
UQC78664.1|GH16_22	1.24e-94	26	369	1296	1635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BMF_A	7.97e-12	382	419	1	38	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]
6MVI_A	4.99e-09	353	418	221	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
4QI4_A	4.22e-07	387	419	553	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	4.79e-07	387	419	775	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
6Q8M_A	7.74e-07	384	419	371	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A024SNB7|GUN1_HYPJR	8.73e-09	382	419	422	459	Endoglucanase EG-1 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=egl1 PE=1 SV=1
sp|P07981|GUN1_HYPJE	8.73e-09	382	419	422	459	Endoglucanase EG-1 OS=Hypocrea jecorina OX=51453 GN=egl1 PE=1 SV=1
sp|Q12714|GUN1_TRILO	2.06e-08	382	419	426	463	Endoglucanase EG-1 OS=Trichoderma longibrachiatum OX=5548 GN=egl1 PE=3 SV=1
sp|A0A024SH76|GUX2_HYPJR	3.53e-07	376	419	20	62	Exoglucanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=cbh2 PE=1 SV=1
sp|P07987|GUX2_HYPJE	3.53e-07	376	419	20	62	Exoglucanase 2 OS=Hypocrea jecorina OX=51453 GN=cbh2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000245	0.999714	CS pos: 24-25. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_68174-t26_1-p1.