CAZyme Information: NEUTE1DRAFT_67790-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_67790-t26_1-p1
• CAZy Family: GH71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2357	GL891306|CGC6	263342.57	6.2543

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891306:3178607-3186322(+)

Full Sequence      

MFMSWGCQPPTARSIEYNLNRNKTATSPLDYWGDRTEDDPNFTYFPSPKNWRVPFYTVFV
DRWVNGEPDNDNANGTLFEADIMSNQLRFGGDVDGIIDSLDYIQGQGVKGIYIAGSPFIN
QPWGADSYSPLDLTLLDKHFGNIKKWQEAIDAIHAHGMWVIMDNTMATMGDLIGFEGYLN
TSTPFLVEEHKVLWKSDRRYLDFDIGNTYNKTCDYPEFWYEDGKRIKPDGLKGCYDSDFD
QYGDIEAFGVFPDWQRQLAKFASVQDRLREWKPDVIARLARFSCMTIGMLDVDGFRIDKA
VQVTVDAQAHFSSAMRKCAKEKFNKDNFIVVGEITSGNTLGSIYLGRGREPEPAEELSDD
PVKALTLGNATTDVSKYFVREKGNSALDAGAFHYSVYRFMTRFLGMSGNLRAGYDLPTDW
IETWHEMIATNDFWNANTGEFDPRHLYGTSNQDVFRWPAIEKGTERMLLAYFITTFLLPG
APLMYYGEEQELYALDGTAENYVYGRQAMAPSPAWMAHGCFSLKNDLYVDWPVTKAKDGC
RDPSVGWDHRNPAAPVRNILKNMFAMRNSTQLGVLEHGWLLEKLSNQTDFTLLKGSGDPT
ERGIWSVVRGLYPGVQDKLKDKPVWFVYHNRENTTTYKFNCDQRESAFLSPFDAGTKVKN
LMDDGDVITLSSSNVKNNYTNSGKNMGCLSEVTLNPFEFRVYVDDPEDRWMQPAPMITKF
TPGHDVPIDSTKANGRIDISFEFNTEMDCDSVTKSLTVNLTQDGVNDPTQLSWTTPNCEV
FTPQDADKIKYTGAINSAWRWNATLTNVADGIIKLTLDPTAAAKGGNVTKGTRDHFLLRL
GKPSNPVVWGMDATYNWDLLQSVSNNLYKIKHNAPGATKWRYSTNFGSTWSEWVDYTGKE
TSVTGQQWSGTALQAWEGKHIQVQYFSKPLGSSAFIQHSDKGIDYQRVFPHIKLHGPFNK
WGYDTGLPGSMDLVGHNTWSLHYMYEWPANFQLNIWGINPDNQPDVSFIFGDIDGDHVVD
RLPPSSLANNVINITDAPPTPALAWKVYYNDATWTYHLEPAGNMNVQIALFWLFAILPVA
LACLAGWIYVTSFYQVKVNKSGFATKGWMPLKIGNLSKLNIANVGKGVEMNAITPPPPSS
ALSPLGAAGGRRTVLIATMEYNIDDFKIKIKIGGLGVMAQLMANALHHMDIVWVIPVVGD
VDYPLEKMQKAEPMYVDVMGQPYEIEVYYYVVKNITYVLLDAPIFRKQTKADPYIARMDD
IESAILYAAWNYCIAESIRRFPVDIYHINDYHGAAAPLYLLPQTIPVCLSLHNAEFQGMW
PMRTPEEAKEVCEVFNLPPEVVKDYVQYGSVFNLLHAGASYLRIHQRGFGAVGVSRKYGD
RSLARYPIFWSLKNIGQLPNPDPSDTADWDPSQDANDQAKGVEVDQAAEEKRGEYRRQAQ
EWAGLEVDPSAELFVFVGRWSLQKGVDLIADLFPSILEKYPKTQLIAVGPVIDLYGRFAA
LKLEKLMQKYPKRVFSKPEFTSLPPYIFTGAEFALIPSRDEPFGLVAVEFGRKGALGVGA
RVGGLGQMPGFWYTVESMTPSHLIQQFRQAIESALACKHNKRAVMRAWSAKQRFPVAQWV
KQLDDLYSESIRIHIKEQKKKKLEVLSPGLTVPGASSRASYADPGSGRSSPGPLAVPSRP
VTPTLRDLASPDLPTPGAPWAGGRSESPGARDSTASSIAGNFYLQPGGARESTMSVDSFA
IRAQNGGPMSPGLGPDGGLAFPRPAFTQAHRNSSLLSLPDVVGDRHDLKLQKVDQFFNDT
NGEYYAEFEQMLEALTASNSSSDLCIETFLKRSEKEWFARYRDAKLGRHRDASRMGRGGS
GRPESRGGDRSESVVSRGRQPMRSATPSGLARSVFEESPPGGRSDYDDEFLLGDGYQAPT
GLKKTLSVRIGDWPLYSFFLALGQIISVNSYQIVLLSGSQAQTPEKLYTVGGVYIATSLM
WWGMERNFKSVYALSAPWFFFGLAFLLLGVAPFIGDWKVADSVTSAATAFYAAGASHGAL
SFALNFGDEGGAPTRQWITRALIVSGIAQVYSLGLWYWGATVSSEAQTMTKFIGESGVPL
ALVICVPVAIFLWAIGAILYVGLPDFYRQSPATIPGFYISLYRRKIVPWFFVMIILQNYW
LSAPYGRSWSFLFSTQFIPNWGIFLMALGFFVVLWSIVLYGFSYFSDEHTWLLPIFAIGL
CAPRWAQEMWACSGIGWYLPWAGGPVGSAVLSRCLWLWLGLLDNIQGVGLGMMLLATLTR
QHVLVVLIGAQVIGSMFTLIGRATSPNALSPNTTFPDFSQGLYPGIASPYFWVCLIFQLI
IPVGFFKFFRKEQVAKP

Enzyme Prediction     

EC	2.4.1.183:18	2.4.1.-:2	2.4.1.183:36	2.4.1.-:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	90	491	2.8e-175	0.9975
GH13	1149	1621	4.2e-73	0.99

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
200462	AmyAc_AGS	0.0	7	567	14	566	Alpha amylase catalytic domain found in Alpha 1,3-glucan synthase (also called uridine diphosphoglucose-1,3-alpha-glucan glucosyltransferase and 1,3-alpha-D-glucan synthase). Alpha 1,3-glucan synthase (AGS, EC 2.4.1.183) is an enzyme that catalyzes the reversible chemical reaction of UDP-glucose and [alpha-D-glucosyl-(1-3)]n to form UDP and [alpha-D-glucosyl-(1-3)]n+1. AGS is a component of fungal cell walls. The cell wall of filamentous fungi is composed of 10-15% chitin and 10-35% alpha-1,3-glucan. AGS is triggered in fungi as a response to cell wall stress and elongates the glucan chains in cell wall synthesis. This group includes proteins from Ascomycetes and Basidomycetes. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
340822	GT5_Glycogen_synthase_DULL1-like	9.77e-109	1154	1629	2	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
223443	AmyA	8.31e-33	55	548	3	392	Glycosidase [Carbohydrate transport and metabolism].
200489	AmyAc_5	7.66e-25	55	528	2	434	Alpha amylase catalytic domain found in an uncharacterized protein family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
223374	GlgA	1.98e-20	1154	1565	3	403	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO58445.1|GH13_22|GT5	0.0	12	2357	29	2370
CDP28899.1|GH13_22|GT5	0.0	17	2357	34	2390
CAP61823.1|GH13_22|GT5	0.0	17	2357	34	2390
VBB80612.1|GH13_22|GT5	0.0	17	2357	34	2389
UQC73771.1|GH13_22|GT5	0.0	11	2357	26	2346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D9B_A	7.79e-14	55	527	145	509	Chain A, Alpha-glycosidase [Weissella cibaria]
7D9C_A	1.78e-13	55	527	145	509	Chain A, Alpha-glycosidase [Weissella confusa],7DCG_A Chain A, Alpha-glycosidase [Weissella cibaria],7DCH_A Chain A, Alpha-glycosidase [Weissella cibaria]
3D1J_A	2.21e-13	1284	1565	131	401	Chain A, Glycogen synthase [Escherichia coli]
2QZS_A	2.28e-13	1284	1565	131	401	Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
7EHH_A	3.08e-13	55	527	145	509	Chain A, alpha-glucosidase [Weissella cibaria],7EHI_A Chain A, alpha glucosidase [Weissella cibaria]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUL4|MOK12_SCHPO	0.0	11	2355	26	2351	Cell wall alpha-1,3-glucan synthase mok12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mok12 PE=3 SV=1
sp|Q09854|MOK11_SCHPO	0.0	7	2357	22	2397	Cell wall alpha-1,3-glucan synthase mok11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mok11 PE=3 SV=2
sp|Q9USK8|AGS1_SCHPO	0.0	1	2357	20	2410	Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ags1 PE=1 SV=3
sp|Q9Y719|MOK13_SCHPO	0.0	13	2357	27	2358	Cell wall alpha-1,3-glucan synthase mok13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mok13 PE=3 SV=2
sp|Q9Y704|MOK14_SCHPO	3.13e-280	1021	2357	131	1369	Cell wall alpha-1,3-glucan synthase mok14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mok14 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.937174	0.062861

TMHMM  Annotations     

Start	End
1068	1090
1935	1957
1967	1984
1991	2013
2023	2045
2058	2080
2100	2122
2146	2163
2183	2205
2282	2304
2324	2346