CAZyme Information: NEUTE1DRAFT_64282-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_64282-t26_1-p1
• CAZy Family: GH64|GH64
• CAZyme Description: feruloyl esterase B precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
292		31002.25	7.9537

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891305:18373-19307(+)

Full Sequence      

MLPKTLLGLALTAATGLCASLQQVTNWGSNPTNIQMYTYVPDKLATKPAIIVALHGCGGT
APSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPASLTHGAGGDSLGIVAMVNYTI
AKYNADASRVYVMGTSSGGMMTNVMAATYPEVFEAGAAYSGVAHACFAGAASATPFSPNQ
TCARGLQHTAEEWGNFVRNSYPGYTGRRPRMQIYHGLADNLVYPRCAMEALKQWSNVLGV
EFSRNVSGVPSQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_64282-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	191	5.7e-26	0.6035242290748899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	2.08e-45	36	248	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	9.59e-26	7	278	17	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.25e-23	39	227	6	188	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	5.98e-09	64	242	1	177	Prolyl oligopeptidase family.
224423	DAP2	1.76e-07	33	162	379	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE75726.1|CE1	1.01e-217	1	292	1	292
CAC05587.1|CE1	1.38e-215	1	292	1	292
AFU88756.1|CE1	1.90e-158	1	292	1	292
QBZ57428.1|CE1	2.21e-157	12	291	12	291
QFP12442.1|CE1	1.63e-149	1	292	1	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	9.09e-84	20	289	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	1.79e-218	1	292	1	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	2.55e-149	1	291	1	291	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	1.45e-101	2	290	3	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	1.42e-100	17	290	17	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|A1DBP9|AXE1_NEOFI	1.15e-84	20	289	33	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000858	0.999118	CS pos: 18-19. Pr: 0.9534

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_64282-t26_1-p1.