CAZyme Information: NEUTE1DRAFT_63306-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_63306-t26_1-p1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	GL891304|CGC15	29641.29	8.9346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891304:2883354-2884362(+)

Full Sequence      

MRRSFQHPLTLLLQTITILCLFPSALASSKTLLIPSTSFNSTTTFNTYWSLNYPWGTDHN
GAARMSPSQVSISPSADGTSSTLTLTAHRVTGQKPATHGGKQIPIKYLSGAIHAKQHFTI
TSSSSSGAGAVSGYDFSAEFRAPVAKGTWPAFWLTAVNGWPPEIDMAEWKGSGKISFNTF
NTSSQVMTRDVVYGPNGSEKEWHRVVCEIRRDGRNGGKDVEVRFWMDGQLVVTQWGKGII
NLQMEGSSGSPGPEVDTLYQVRNLEVWSYGD

Enzyme Prediction     

EC	3.2.1.181:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	47	252	1.4e-75	0.9897959183673469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	2.86e-11	39	257	5	220	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	4.57e-07	39	233	3	167	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185687	GH16_beta_agarase	1.11e-04	36	241	26	213	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
185690	GH16_fungal_Lam16A_glucanase	0.001	143	168	91	117	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185691	GH16_Strep_laminarinase_like	0.007	145	233	104	202	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KHE89680.1|GH16_10|3.2.1.181	1.59e-174	1	271	31	300
QBZ59743.1|GH16_10	1.78e-88	33	269	29	256
UQC81933.1|GH16_10	1.33e-86	33	269	68	292
AEO69030.1|GH16_10	4.71e-85	26	244	22	220
AEO58155.1|GH16_10	5.89e-80	25	240	17	212

PDB Hits     

NEUTE1DRAFT_63306-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F7J1C8|E3GAL_FLAVE	4.88e-63	34	271	25	249	Galactan endo-beta-1,3-galactanase OS=Flammulina velutipes OX=38945 GN=EN3GAL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000264	0.999705	CS pos: 27-28. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_63306-t26_1-p1.