CAZyme Information: NEUTE1DRAFT_61616-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_61616-t26_1-p1
• CAZy Family: PL4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		44124.07	6.4280

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:5072993-5074456(-)

Full Sequence      

MQLTRLQVLAAGLVPAMVSARALSPRAVDCAFATTADAGATCESFAASWGQSVDELKKLN
PGITCPNLDTSKTYCVIGTVTADPTPSSSSSSSSSSSTSTTLKTTTTTKVSTTSSSTSTS
SSTTAAPAPSNSPAMPGLAANCDGFYKVASGDSCDTIASKNGITTTQFKTWNTEINAECS
NLWLDYYVCVHVPGAAAPTTTTKVTSTTAAPAPTNSPQMPGLAANCDGFYKVASGDSCDT
IASKNSITTTQFKSWNTEIDAECSNLWLGYYVCVHVPGAVTQKPTTTTKATSTAPAATNS
PQMPGIVSNCDGYYKVASGDQCSTIAAKYGITTDQFLSYNSYINAQCSNLWVDYYVCVHA
TPSPLMPGIAGNCKRYHQVKSGDSCSSIASSAGITFNQFRQYNTQVNADCSNLWLGYYVC
TGV

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.54e-10	375	419	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	8.69e-10	313	356	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	2.48e-09	145	188	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
180536	PRK06347	4.79e-09	146	407	333	570	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	1.00e-08	229	272	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS23655.1|CBM50	2.81e-110	1	358	1	330
BCS16287.1|CBM50	5.34e-108	1	423	1	339
BCS04718.1|CBM50	5.34e-108	1	423	1	339
UQC75372.1|CBM50	1.06e-88	1	276	1	265
BCS24217.1|CBM50	1.10e-83	12	276	9	258

PDB Hits     

NEUTE1DRAFT_61616-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.74e-58	133	422	146	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	2.53e-15	22	194	23	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.01e-11	132	358	252	534	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AY86|LYSM6_ARTBC	2.10e-11	301	358	362	419	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2
sp|D4B5F9|PGDA_ARTBC	6.69e-11	367	423	381	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001457	0.998541	CS pos: 20-21. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_61616-t26_1-p1.