CAZyme Information: NEUTE1DRAFT_50259-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_50259-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		30191.23	7.2558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:3409007-3409951(-)

Full Sequence      

MRSSTVLQTGLVAALPFAVHAASGSGQSTRYWDCCKPSCSWSGKASVNRPVLACDANNNP
LSDASVKSGCDGGSAYTCANNSPWAVNDQLAYGFAATKLSGGTESSWCCACYALTFTSGP
VAGKTLVVQSTSTGGDLGSNHFDINMPGGGVGLFDGCTRQFGGLPGAQYGGISSRSQCDS
FPAALKPGCQWRFDWFQNADNPNFTFKQVQCPSELTSRTGCKRNDDSQFPVFTAPSGGGT
NPSTPTTPPSSGGGSGCTADKYAQCGGSGWSGCTNCPSGSTCKTINDYYHQCA

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	26	222	1.4e-87	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	6.90e-88	25	222	1	214	Glycosyl hydrolase family 45.
395595	CBM_1	7.44e-10	261	289	1	29	Fungal cellulose binding domain.
197593	fCBD	5.39e-08	261	292	2	33	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27871.1|CBM1|GH45|3.2.1.4	7.07e-214	1	293	1	293
CAD70529.1|CBM1|GH45|3.2.1.4	7.07e-214	1	293	1	293
AAY00849.1|CBM1|GH45	3.92e-169	1	292	1	298
CAH03187.1|CBM1|GH45	3.92e-169	1	292	1	298
AEO64667.1|CBM1|GH45|3.2.1.4	3.92e-169	1	292	1	298

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	2.44e-215	1	293	1	293	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	6.47e-137	22	233	1	212	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	7.46e-137	22	233	4	215	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1OA7_A	1.11e-128	25	236	2	213	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
1L8F_A	1.36e-125	25	229	2	206	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	3.60e-124	1	232	1	230	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	2.12e-118	26	235	3	213	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	6.19e-82	11	223	7	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	1.16e-62	23	221	37	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	2.10e-50	25	224	268	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999698	CS pos: 21-22. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_50259-t26_1-p1.