CAZyme Information: NEUTE1DRAFT_50117-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_50117-t26_1-p1
• CAZy Family: GH45
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	GL891307|CGC4	88417.62	7.6077

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:3230597-3233516(+)

Full Sequence      

MKVFARIGTIALAALYLQQCSAQYINEQYTDPVNKITLSTWRPDPGSNSGGGDAATYAFG
LVLPPDALTKDANEYIGLLRCDVGDAASPGWCGVSHGQSGQMTQSLLLMAWASKGQVFTS
FRYASGYNVPGLYTGNATLTQISATVNSTQFELIYRCQDCFAWNQGGSKGSVSTSSGLLV
LGRAAAKGNLQNPTCPDKAIPGFHDNGFGQYGAPLEKVPHTSYSAWASLATKTTTADCSG
ASDPAPTGSEPPAEPTSTAEPVPVCTPAPSKTYDYIIVGAGAGGIPIADKLSEAGKSVLL
IEKGPPSTGRWNGTMKPEWLQATNLTRFDVPGLCNQIWVDSAGIACTDTDQMAGCVLGGG
TAVNAGLWWKPHPQDWDYNFPEGWKSRDTVPATNRVFGRIPGTWHPSQNGKLYRQEGFNV
LANGLSKSGWKEVIPNDAYNQKNHTFGHSTFMFAKGERGGPLATYLVTAAARKQFTLWTN
VAVRRAVRNGSRVTGVELECLTDGGLSGTVNVTPNTGRVIFAAGTFGSAKLLLRSGIGPT
DQLEIVKGSTDGPTFISKDQWIDLPVGYNLMDHLNTDLIITHPDVVFYDFYGAWNTPIEG
DKSAYLQNRSGILAQAAPNIGPLMWDELKGSDNIVRTLQWTARVEGSDQYTTSKHAMTLS
QYLGRGVVSRGRMAISSGLDTNVAEHPYLHNDVDKQTVIQGIKNLQAALNVIPNISWVLP
PPDTTVESFINNIIVSPSNRRSNHWMGTAKLGKDDGRAGGSAVVDLNTKVYGTDNLFVVD
ASIFPGMTTGNPSAMIVIASEHAAQKILALKPVPSLPGGNGKGKWRR

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	263	810	1.1e-246	0.9854014598540146
AA8	29	226	8.5e-59	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	6.62e-62	29	222	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	6.97e-51	268	812	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	5.89e-39	28	215	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	4.92e-30	270	814	3	538	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.11e-24	669	803	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28998.1|AA3_1|AA8|1.1.99.18	0.0	1	827	1	828
AEO64604.1|AA3_1|AA8	0.0	1	811	1	787
AEO59298.1|AA3_1|AA8|1.1.99.18	0.0	1	811	1	786
ADT70772.1|AA3_1|AA8|1.1.99.18	0.0	1	811	1	786
VBB79670.1|AA3_1|AA8	0.0	1	811	1	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	29	817	8	774	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	1.71e-314	29	817	7	773	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.18e-255	272	817	7	552	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	8.34e-136	273	814	3	541	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	9.76e-136	273	814	8	546	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	8.40e-162	7	814	2	773	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	2.98e-26	273	814	5	537	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q47944|SDH_GLUOY	3.17e-25	273	807	5	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	3.92e-25	273	814	5	537	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|C3MIE4|BETA_SINFN	1.99e-23	274	813	4	531	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000860	0.999134	CS pos: 22-23. Pr: 0.6431

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_50117-t26_1-p1.