CAZyme Information: NEUTE1DRAFT_49508-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_49508-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	GL891307|CGC7	30296.67	7.2747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:3272968-3274005(+)

Full Sequence      

MWPSPKAAYLLLLARSALVGASPVELEERQSCPSIHVFGARETTVSPGFGTAGVVVNLIL
QAYPGATSEAIVYPACGGQSSCGGVQYGDSARQGTDAVATAVNSLNARCPDTQIVLVGYS
QGGQIMDNAVCGGPDSGAGITTSTPGINASALNQVKAVIMMGNPRYRAGLSYNVGTCTAY
GFDPRPAGYTCASASKLQNYCDSPDPYCCTGNDAATHQGYGSKYGQQALAFVKSKLSSGG
GGGGSTPTNPSNPSTPTTPSTGNCAAKWGQCGGQGWTGATCCQSGSTCQAANQWYSQCV

Enzyme Prediction     

EC	3.1.1.72:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	31	236	2.2e-43	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.94e-65	31	236	1	173	Cutinase.
395595	CBM_1	6.28e-12	267	295	1	29	Fungal cellulose binding domain.
197593	fCBD	7.24e-12	266	299	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
369775	PE-PPE	2.50e-04	64	129	1	65	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70564.1|CBM1|CE5	7.45e-201	1	299	1	300
VBB81490.1|CBM1|CE5	3.03e-147	1	299	1	309
CDP29692.1|CBM1|CE5	1.23e-146	1	299	1	309
CAP62281.1|CBM1|CE5	1.23e-146	1	299	1	309
AEO60460.1|CBM1|CE5	8.97e-143	1	299	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	2.07e-100	31	236	1	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	8.37e-100	32	236	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
1QOZ_A	6.82e-99	32	237	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
2AXE_A	5.56e-98	31	236	1	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
5X39_A	4.27e-07	265	299	2	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2J8C362|CUTI1_VERDA	2.83e-137	11	299	6	295	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	6.57e-121	3	299	2	302	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	1.00e-101	19	236	13	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|E7EF85|XYNB_PENOX	4.94e-13	262	299	274	310	Endo-1,4-beta-xylanase B OS=Penicillium oxalicum OX=69781 GN=xynB PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	1.19e-12	262	299	393	429	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000452	0.999516	CS pos: 21-22. Pr: 0.9381

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_49508-t26_1-p1.