CAZyme Information: NEUTE1DRAFT_39943-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_39943-t26_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		43290.06	7.3130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:5031852-5033027(-)

Full Sequence      

MLTNLKLTTLFLSFHFAVAALAGRCKPDPPPFSTFPRRIIYDPPAGKRASYPRHVELKDG
TFLVTSSIIGGDFFAGSNSSFPVFESKDGGVHWKWISNITDQVNGWGMSAQPALLELQKP
LGGFRAGTILFSGNSWSENGTRIDLYASTDKARTWKFVSHVAEGGRPNTTNGATPVWEPF
LLEYKDELIVYYSDQRDPKHGQKLAHQRSKDLRTWGPVVNDVRYDEYLARPGMTVVAKIE
TINKWILVHELPVGNSSSYGVNYPVYYHIADEPTKFDSAPGIPIVIDGKLAPNASPYVVW
SPAGGPNGTIVVSDADRSEIYTNRFGGDPDKWEMHAIEQPAAYSRALHIFRRDPKKLMVL
GGATFDEGGPDELSLSVLNLIEVLKTRVHPA

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_39943-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	48	359	8.9e-103	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	0.002	62	221	93	243	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.005	52	218	54	201	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28974.1|GH93	2.21e-296	1	391	1	391
CAB91342.2|GH93	8.28e-285	1	391	1	381
CDP29096.1|GH93	1.01e-212	19	389	18	386
CAP62021.1|GH93	1.01e-212	19	389	18	386
VBB80841.1|GH93	1.01e-212	19	389	18	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5N_A	1.59e-98	34	386	10	367	Chain A, Alpha-l-arabinofuranosidase [Fusarium graminearum]
2YDT_A	3.19e-98	34	386	10	367	Chain A, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],5M1Z_A Chain A, Exo-1,5-alpha-L-arabinofuranobiosidase [Fusarium graminearum]
2YDP_A	2.56e-97	34	386	10	367	Chain A, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_B Chain B, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum],2YDP_C Chain C, Exo-1,5-alpha-l-arabinofuranobiosidase [Fusarium graminearum]
2W5O_A	2.32e-95	34	386	10	367	Chain A, ALPHA-L-ARABINOFURANOSIDASE [Fusarium graminearum]
3A71_A	1.70e-80	40	384	11	355	High resolution structure of Penicillium chrysogenum alpha-L-arabinanase [Penicillium chrysogenum],3A72_A High resolution structure of Penicillium chrysogenum alpha-L-arabinanase complexed with arabinobiose [Penicillium chrysogenum]

Swiss-Prot Hits     

NEUTE1DRAFT_39943-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000353	0.999622	CS pos: 22-23. Pr: 0.9590

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_39943-t26_1-p1.