CAZyme Information: NEUTE1DRAFT_37265-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_37265-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1001	GL891302|CGC16	111758.62	6.7297

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891302:1194380-1197648(+)

Full Sequence      

MAGSHFPLRPLPPSRNPSGTPSDYPLLRPLPPSRNPSATPSDHPLPRPLPPSRNPSATPS
DVSSLRPLPPLKIPSSTPSGFPSPLNSPPRSNFQHGPTSGVDTLPSPGLQGSESFYNQNA
TGSALSVASDQTGVSAPVAYADEFRFKIMIQYLSKQIDKAGWIPSEKNKKTPNRYGVLYK
KSRGRYVTYPEELSQALVACVQRLNLVVAFTMKPDMLDGILASLRPNQSELKLMDGSQLQ
IADSLNSMVPANVKKFQYACLVRQEGILLVWHDDLLHIVPTAARIEEKLLAMVWGTGQLP
FGRLQAPSRPGSILSTNTSIYKVDKPSTPGPGNMGALPNDSAEQLEKDESVDAKESLQRP
VQRTSAFFVGMAMCLGIVLLFGTYIQKLLIECVIDGTYTRLALIVCVPFLLCVSLFFFQV
IFSNFFQIFGPIGGQHTNSRFYSCIKPSLRRAYMDGFTAPHITIQMPVYKEGMESVIIPT
VRSLQAAISFYESHGGSASIFVNDDGLRVVSEEEAQKRIEFYHDNNIGWVARPKHGDDGF
VRKGKFKKASNMNFALNISQKVEKYLQEMVDAKFAAEGTDLIDQQEEEEMYEAALARVLE
ENPLAQAAGNIRMGEYILIVDSDTRVLLLQPVDCLLYGAAELFLSPEVAIVQHSTGVMQV
SWDYFENGITFFTNLVYTAIRFSIGSGEVAPFVGHNAFLRWQAVQDVGVPEPNDYTAYWS
ESHVSEDFDIALRLQIKGSIVRIASYHGTQFQEGVSLTIYDEIARWQKYAYGVSEMIFHP
FHRWIFKGPFTPLFYTYLGSNIMYSSKISIFAYMCSYFALASALMLTLLNYFLVGWFIDT
LDHAYMSSWEVFISLVVVFNVMGHIALAALRYRTGDRGLLSSLCENFKWTPMMTIFFGGL
SFHVTTALLAHLFHIDMQWGATSKEKENSNFFQEIPKILKTFKWMYVFVILVAAGMIYLG
NWAPEGWEIKDFSAIVPLAINLISHALTPLVLNPSLMVFNY

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_37265-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	616	837	2.7e-49	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	4.33e-48	616	826	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	5.86e-09	464	727	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	2.35e-07	614	887	138	395	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
177464	PHA02682	7.22e-05	7	110	81	195	ORF080 virion core protein; Provisional
397323	Atrophin-1	1.55e-04	11	111	172	270	Atrophin-1 family. Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC28725.2|GT0	0.0	1	1001	1	1003
EAA31489.2|GT0	0.0	248	1001	1	752
UNI18966.1|GT0	0.0	109	1001	15	905
QLI74022.1|GT0	0.0	107	1001	8	902
QUC19563.1|GT0	0.0	91	1001	4	911

PDB Hits     

NEUTE1DRAFT_37265-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

NEUTE1DRAFT_37265-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

Start	End
366	388
401	423
816	838
851	873
893	915
942	964
974	996