CAZyme Information: NEUTE1DRAFT_36383-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_36383-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: endo-1,4-beta-xylanase 2 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		27102.66	9.5200

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891302:224584-225566(+)

Full Sequence      

MVAFSSILLAASTVISGVFALPGELPGQGSLFKRQTYTSSATGTHNGYYFSFWTDGQGSV
RYTNEAGGQYTATWSGNGNWVGGKGWMPGTDRTINYTGTYSPNGNSYLAVYGWTRNPLIE
YYVVENFGTYNPSTGATRLGSVTSDGGVYDIYRTQRVNQPSIDGTATFYQYWSVRQQKRT
GGSVNMKNHFDAWTRSGLTLGTHNYQIVATEGYFSSGSSTINVGASSDGGGGGGTTPENP
VRISGRLSLSRK

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	46	221	4.8e-76	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	6.50e-109	46	220	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD71059.1|CBM1|GH11	4.80e-167	1	226	1	226
CDP26454.1|CBM1|GH11|3.2.1.8	2.87e-132	1	227	1	224
VBB76545.1|CBM1|GH11	2.87e-132	1	227	1	224
CAP60973.1|CBM1|GH11|3.2.1.8	2.87e-132	1	227	1	224
ACR92593.1|GH11|3.2.1.8	6.60e-132	1	228	1	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XNK_A	2.14e-116	36	227	2	194	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
1H1A_A	1.04e-115	36	224	2	191	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
4XQD_A	3.21e-100	42	223	6	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
5K7P_A	3.33e-100	42	223	7	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
2JIC_A	3.33e-100	42	223	7	189	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36217|XYN2_HYPJR	8.87e-105	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyn2 PE=1 SV=2
sp|G0RUP7|XYN2_HYPJQ	8.87e-105	1	223	1	222	Endo-1,4-beta-xylanase 2 OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=xyn2 PE=1 SV=1
sp|B5A7N4|XYN2_TRIHA	1.11e-102	1	223	1	220	Endo-1,4-beta-xylanase 2 OS=Trichoderma harzianum OX=5544 GN=Xyn2 PE=1 SV=1
sp|Q2PGY1|XYNA_PENCI	1.85e-100	13	223	5	216	Endo-1,4-beta-xylanase A OS=Penicillium citrinum OX=5077 GN=xynA PE=1 SV=1
sp|P48793|XYN_TRIHA	2.30e-97	42	223	7	189	Endo-1,4-beta-xylanase OS=Trichoderma harzianum OX=5544 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000363	0.999602	CS pos: 20-21. Pr: 0.9701

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_36383-t26_1-p1.