CAZyme Information: NEUTE1DRAFT_149191-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_149191-t26_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		90466.96	4.9905

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891382:234704-237340(-)

Full Sequence      

MRLKATVLAALASVASAAYWMEETQHQGVASFNPDKSYQVFRNVKDYGAKGDGVTDDTIA
INNAISSGNRCGGGPFCNGTTTTPAVVYFPAGTYLVTTNIINYYYTQIIGDPTSMPVIKG
SPDFQSYGGIGLIDSDPYLNSGTLQFRATNVFFRQIRNLIFDTTDVPGTVAGLHWPSSQA
TSIQNCVFKLSSRPEDDHTGIFIEEGSGGMLADLVFYGGRQGAQFGNQQYTMRNLTFYGS
KTAIMQLWNWGWTYKSLNIYDCEVGINMSSNAVGSVTLLDSRFVNVQTAMTTFRGATSIN
STGSLVIENVDYINVPIVLQGPEGPILLGNPSGLVHDAGYARGNTYTPNGPREYEDRDRA
YFRQPTTLKQDGKFYERSKPQYETYPTWAFLSARSYGAVGDGVTDDTAALNHLFQTAGLT
LGSVAYLDAGYYKVTDTVHISGGVRVVGEAMAAVILGAGPKFSDINNPQPVLQIGNMGEA
GYVEVSDIIVSTQGGTAGAVLIQYNLNPPAGSSSTLAEMPPSGLWDVHTRIGGFAGSNLQ
LTDCPKTPDAVVHADANCIAAWLSFHVTKRAGNLYMENNWFWVADHDIEDFNNTQISIFA
GRGVLIEGERVWLVGTASEHHTLYQYQLLNATDVFMGQAQTETPYYQPNPPAPLPFTRID
TTLGDPDFHTDCQSVQYGANTTISSDGSLTLGGNPKCEMAWGLRILGSQNVVVFGAGLYS
FFNNYNVDCSTLRSGENCQARIFWAGPLNLGSGFSTNVPPREVGSGKTGKFVMSSKPPSH
RNKSSESSGDAADPWVQVYNLNTVGSVSMITRDGKDLAGWNQNLATFANTLALFHY

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	12	744	4.4e-266	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	7.59e-94	41	267	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.54e-07	390	505	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	3.78e-05	43	95	84	125	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35992.1|GH55	0.0	1	836	1	836
VBB84839.1|GH55	0.0	12	834	12	787
AEO64870.1|GH55	0.0	7	834	7	781
AEO61209.1|GH55	0.0	17	806	17	760
CDP31588.1|GH55	1.37e-283	12	834	12	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	3.20e-201	15	834	2	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.50e-190	19	742	26	708	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	1.82e-08	43	125	76	159	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	9.82e-205	19	836	48	786	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	3.41e-187	16	835	40	874	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	8.15e-45	35	750	58	718	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999731	CS pos: 17-18. Pr: 0.9696

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_149191-t26_1-p1.