CAZyme Information: NEUTE1DRAFT_148997-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_148997-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		51018.78	5.1631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:3250430-3251870(-)

Full Sequence      

MRREVFFALQAAFLLLIVLSLYLGHDQLSQISPSFLKPNHWIHVNGTQASVSAIASPTTT
TNATTTVANPTATTPADNVPIPTVLSAANRTAYVAAIMNPDEKNLPRLECPTFNPSRYEY
LAVQDDEGEADVSGIQYFFALDLRECLHLLPRLIGSIVEAIRFLGPQSCALSIIEGNSHD
GTAEVLAALRPELDALTTTYYFKSSDINPKQGDRITKLAELRNLALQPMLDPNNSKLYPA
EANTTVIFLNDVAACTDDILELVHQRRFLGADMTCAMDWTYAGQDPTFYDVWIARTLAGG
DSFFDIPADGNWNSAWNIFWNEPTARERYLAHQPFQVFSCWNGATAFTAKPFLEKKVTFR
APRKGECMQGEPQLLCKDFWWHGYGKIAVVPTVNLEYSDEKGKKIKEAKGFTSHLVGAEG
HRDDAIQWQASPPEKVKCMPDYAHQFFEEWNKTQPGV

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_148997-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	136	380	3.7e-76	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	4.17e-103	136	375	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA28991.1|GT69	0.0	1	457	1	457
AEO64631.1|GT69	8.42e-201	1	457	1	442
CAP61615.1|GT69	9.63e-193	98	457	1	355
CDP27968.1|GT69	9.63e-193	98	457	1	355
VBB79635.1|GT69	2.25e-191	98	457	1	355

PDB Hits     

NEUTE1DRAFT_148997-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	2.21e-56	136	440	128	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.837809	0.162204

TMHMM  Annotations     

Start	End
5	24