CAZyme Information: NEUTE1DRAFT_148593-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_148593-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611	GL891307|CGC8	66113.03	5.0916

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891307:1140515-1142416(+)

Full Sequence      

MGSVAVPLAGLEESYDYIIVGGGTAGCVLANRLTEDKDVRVLLLEAGDDRTTDPLVLTPG
LVAGVYGKDEYDWNFQSVPQSTLNNRIINQARGKMLGGSSALNFMMLVYPSRASIDAWAA
VGNPSWNFEALKPYLKKFATVDVPSASTKDICSITYNNDTVAYGDGPVQVSFGEGYGVTN
KGWFDTFESLDLLSKKDARDGQALGAFQNASSIDPATKTRSFSAVTYLTPEVRARENLKI
LTNTHVNKVLFDTTGPEPVATGVEINVNGIISQVSANLEVILSAGALQSPQILELSGVGN
KEILAQHNIPVVVENPAVGEGMQDHPIVCQSFEVKEGTPSGDVLRDPAVLKALLDMYTAD
RSGPMGQLTISVAYTPLVNKTGVISDEGVKKLFAGRDFSNPARAAIRDIVTNPNEPTFQY
ILFPTQVHIADKPHNMATHLIPVEPENFLTVMTILNSPFSRGSVHIQSSDPKAAPVWDPK
YNHDDLDMELLARGVQFVEHLVAPESALGKLLNQTGRRLPQLKGDDLETAKEIVRQRQIS
VFHVSGSCSMRPREQGGVVNERLQVYGAKGLRVVDASIFPIEPAGNIQSVVYSVAERAAD
LIKEDRKAVKV

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_148593-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	605	3.3e-176	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.27e-102	12	603	3	532	choline dehydrogenase; Validated
225186	BetA	4.44e-84	12	608	5	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.03e-31	458	598	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.90e-30	2	591	43	565	Protein HOTHEAD
366272	GMC_oxred_N	2.56e-26	81	327	12	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD60572.1|AA3_2	1.25e-290	11	608	6	607
CDP29465.1|AA3_2	1.25e-290	11	608	6	607
VBB81258.1|AA3_2	2.92e-289	11	608	6	607
AEO60130.1|AA3_2	9.38e-277	11	606	7	608
UKZ84858.1|AA3_2	2.98e-242	14	608	7	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	6.89e-73	14	608	5	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	9.60e-67	15	606	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.38e-65	15	606	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	6.64e-62	11	607	2	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	1.95e-56	11	605	32	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.75e-103	11	605	10	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	1.32e-90	11	605	10	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.32e-90	11	605	10	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.10e-87	7	608	32	635	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	7.46e-81	13	602	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999797	0.000268

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_148593-t26_1-p1.