CAZyme Information: NEUTE1DRAFT_148325-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_148325-t26_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
556		61129.56	5.8485

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891306:3620534-3622204(+)

Full Sequence      

MKGLSNLITQILGFVPTRQSSPQPQTQVQAQIQPPSYCPDYSSYAKTRHEPFSTGRHALP
YQRPAPSCRTFNSSVIESFISNMSTIITDPDLYRLFENTYPNTLDTAIKWHGSAANNSAE
ELTFIITGDINAMWLRDSANQLASYLPFLAPSSSRDSLASLYRGVINLQARYLLTSPFCN
SFQPPSESGIPPATNSAASSDTVYPPYDPEKVFECKYELDSLASFLQISAQYHAATNDTA
FFGRFQWLEAVQTVLDTAKAMMTPTYGPEGQVLESPYTFTRMTTRTTETLANDGLGNPVA
RDIGLIRSAFRPSDDSTIFQFLIPSNMMFAKYAGDVASIVSSLSSLSGTQPGLKTPPANL
STSLSSLSTSLRQAISKHAIISLPTLNSTETTEKVYAYEIDGYGSFSLMDDANLPSLLSA
PLFDYFSSSSSSSNSSSDPVYQRTRSHLLGTNTNPYMMHGPVINAVGGPHAGPGMAWPMA
SIVRIMTSSDDEEIYAVLKELVGSTDGLGLIHESVNSFDSRKWTREWFSWANGLFGQMVW
DLVRRNKGRVLRRGYQ

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_148325-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	89	539	2.3e-158	0.9950248756218906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	89	540	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.86e-114	67	553	1	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA30843.1|GH125	0.0	1	556	1	555
AEO64752.1|GH125	2.52e-232	36	556	23	528
QRC91719.1|GH125	1.04e-215	38	548	21	506
AEO59406.1|GH125	1.76e-215	38	527	29	518
QBZ57723.1|GH125	3.99e-213	38	556	62	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	3.36e-80	63	550	43	474	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.21e-79	63	550	23	454	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	6.55e-75	63	550	21	456	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	3.68e-62	75	547	11	427	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]
6RQK_A	2.39e-61	75	547	11	427	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.70e-129	38	545	27	499	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000006

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_148325-t26_1-p1.