CAZyme Information: NEUTE1DRAFT_146345-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_146345-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		54108.97	5.9574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891304:2508824-2510347(-)

Full Sequence      

MSLPKDFLWGFATAAYQIEGAIHADGRGPSIWDTFCNIPGKIADGSSGAVACDSYNRTKE
DIDLLKSLGATAYRFSISWSRIIPVGGRNDPINQKGIDHYVKFVDDLLEAGITPFITLFH
WDLPDGLDKRYGGLLNREEFPLDFEHYARTMFKAIPKCKHWITFNEPWCSSILGYNSGYF
APGHTSDRTKSPVGDSAREPWIVGHNLLIAHGRAAKAYREDFKPTQGGEIGITLNGDATL
PWDPEDPLDVEACDRKIEFAISWFADPIYFGKYPDSMRKQLGDRLPEFTPEEVALVKGSN
DFYGMNHYTANYIKHKKGVPPEDDFLGNLETLFYDKKGNCIGPETQSFWLRPHAQGFRDL
LNWLSKRYGYPKIYVTENGTSLKGENAMPLKQIVEDDFRVKYFNDYVNAMAKAHSEDGVN
VKGYLAWSLMDNFEWAEGYETRFGVTYVDYENDQKRYPKKSAKSLKPLFDSLIKKD

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	468	2.3e-159	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	2	466	4	445	Glycosyl hydrolase family 1.
225343	BglB	1.43e-142	1	471	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	6.46e-107	4	462	31	473	beta-glucosidase
215435	PLN02814	4.81e-106	2	462	27	473	beta-glucosidase
184102	PRK13511	1.46e-105	2	475	4	469	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO69521.1|GH1|3.2.1.21	0.0	1	476	1	476
AII80277.1|GH1	0.0	1	476	1	476
BAA74958.1|GH1|3.2.1.21	0.0	1	476	1	476
CAP69093.1|GH1	0.0	1	476	1	476
CDP32570.1|GH1	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	0.0	1	476	24	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	7.37e-277	3	476	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.01e-274	1	476	1	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
3AHY_A	1.06e-273	3	473	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]
5BWF_A	1.66e-273	3	476	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.55e-202	3	473	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.81e-185	3	473	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	3.16e-145	2	468	49	518	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.78e-144	2	462	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|Q7XKV5|BGL11_ORYSJ	2.32e-144	2	466	39	505	Beta-glucosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU11 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000003

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_146345-t26_1-p1.