CAZyme Information: NEUTE1DRAFT_133744-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_133744-t26_1-p1
• CAZy Family: GH142|CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298		32103.09	4.4287

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891382:7855134-7856063(+)

Full Sequence      

MLLSLRFLILTISFLASLASARDVPSNLQNLYTKLLKQKKCKHPLASGFYSTADGPNTYS
YCGDHLSDFRILYIRGRGRGRLANMDVDCDGVQGGASDDGRCSIGVSADYQSTTAFQDMV
AAYNVSGVRDLNTYVHPYVVFGNEVENDNNGKDLRWNVFDPRAYLVEPLSVMAVVCDGGS
KLVYGVWGDTNGDDGDKSMVGEASLALATACGGGEMSGSNGIDEEDVLYLAFVGSEAVPG
KMGAKWDAGSFDEFERSIEGLGDHLIQRIPADGKASGTVRVSWGLMIWMFVALGDMCD

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_133744-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	10	268	9.5e-78	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	1.32e-83	85	268	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA36355.3|GH75	1.22e-200	1	293	1	297
UNI20522.1|GH75	1.74e-99	8	273	7	260
AEO60909.1|GH75	6.05e-99	20	277	17	262
AEO66412.1|GH75	9.18e-99	16	269	9	250
AEO59530.1|GH75	7.00e-96	20	283	209	479

PDB Hits     

NEUTE1DRAFT_133744-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	3.95e-53	18	271	15	242	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	1.88e-48	15	271	11	245	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.88e-48	15	271	11	245	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U1H5|CSNB_ASPOR	3.33e-48	19	271	15	241	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	2.95e-45	9	271	6	238	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999800	CS pos: 21-22. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_133744-t26_1-p1.