CAZyme Information: NEUTE1DRAFT_131199-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_131199-t26_1-p1
• CAZy Family: GH131
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53608.73	10.3015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891306:1806750-1808189(+)

Full Sequence      

MATTSPAAPKPKPKSSSLLSTLFSRPLPLYVSAFLLRLVLLLYGLWQDANSPLKYTDIDY
LVFTDAARFVSRGESPYARETYRYTPILAWLLLPTTWTAGAQWGPLAAKVINVAWFSFGK
VLFAAADLVAGWLIEQVLVMGKDFPSSPAQGKENDTERKEGGRKDPSETTTGMDPSRARA
FAAIWLLNPMVATISTRGSSEGLLGVLVMALLWAVLSRRITLAGLLLGFSVHFKIYPFIY
APAIVWWMDQERLSGFRAGGGQKTSSSFRKKLTRFLTLPRLLLAFTSLATFLSLNFLMYR
LYGHPFLQETYLHHVTRIDHRHNFSPYNTQLYLSSASVSPSHSAAEPKFKIESLAFLPQL
VLSTILIPLTLAKKDLPTSLLAQTFAFVTFNKVCTSQYFLWYLVLLPLYLPRSSFWTSKR
RGLVALGLWVLGQGLWLQQAYELEFLGRSTFLPGLWMASLGFFVVNCWILGVIVGDGGR

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	194	474	1.5e-98	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.06e-77	46	474	28	415	GPI mannosyltransferase
252941	Mannosyl_trans	1.22e-73	194	474	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81264.1|GT50	1.77e-208	9	476	10	441
CAP65259.1|GT50	1.18e-206	9	476	10	441
CAD60578.1|GT50	1.18e-206	9	476	10	441
CDP29471.1|GT50	1.18e-206	9	476	10	441
QBZ54528.1|GT50	2.81e-187	7	476	2	426

PDB Hits     

NEUTE1DRAFT_131199-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	0.0	1	479	1	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.01e-173	23	479	7	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	2.11e-171	19	476	1	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	5.23e-169	19	478	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	5.26e-167	19	478	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000011	0.000003

TMHMM  Annotations     

Start	End
27	46
112	134
194	216
223	245
276	298
353	372
387	409
422	437
452	474