CAZyme Information: NEUTE1DRAFT_129729-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_129729-t26_1-p1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829		88433.99	6.8933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891304:2771649-2774337(-)

Full Sequence      

MRTTSAFLSGLAAVASLLSPAFAQTAPKTFTHPDTGIVFNTWSASSSQTAGGFTLGMALP
SNALTTDATEFIGYLECSSAKNGANSGWCGVSLRGAMTNNLLITAWPSDGEVYTNLMFAT
GYAMPKNYAGDAKITQIASSVNATHFTLVFRCQNCLSWDQDGVTGSISTSNKGAQLGWVQ
AFPSPGNPTCPTQITLSQHDNGMGQWGAAFDSNIANPSYTAWAAKATKTVTGSCSGPTTT
SIAATPVPTGVSFDYIVVGGGAGGIPVADKLSESGKSVLLIEKGFASTGEHGGTLKPEWL
QNTSLTRFDVPGLCNQIWVDSDGIACSDTDQMAGCVLGGGTAINAGLWYKPYTKDWDYLF
PSGWKGSDIADATSRALSRIPGTTTPSQDGKRYLQQGFEVLASGLKASGWKEVDSLKDSE
QKNRTFSHTSYMYINGERGGPLATYLVSAKKRSNFKLWLNTAVKRVIREGGHITGVEVEA
FRNGGYSGIIPVTNTTGRVVLSAGTFGSAKILLRSGIGPKDQLEVVKASADGPTMVSNSS
WIDLPVGHNLVDHTNTDTVIQHNNVTFYDFYKAWDNPNTTDMNLYLNGRSGIFAQAAPNI
GPLFWEEITGADGIVRQLHWTARVEGSFETPDGYAMTMSQYLGRGATSRGRMTLSPTLNT
VVSDLPYLKDPNDKAAVVQGIVNLQKALANVKGLTWAYPSANQTAADFVDKQPVTYQSRR
SNHWMGTNKMGTDDGRSGGTAVVDTNTRVYGTDNLYVVDASIFPGVPTTNPTAYIVVAAE
HAAAKILAQPANEAVPRWGWCGGPTYTGSQTCQAPYKCEKQNDWYWQCV

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	240	789	2.7e-252	0.9890510948905109
AA8	30	222	1.1e-63	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.15e-67	30	212	1	172	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
187688	CDH_like_cytochrome	4.22e-46	29	210	1	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
225186	BetA	1.38e-42	270	788	25	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.62e-35	332	784	79	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.19e-33	647	782	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA27355.1|AA3_1|AA8|CBM1|1.1.99.18	0.0	1	829	1	829
VBB86384.1|AA3_1|AA8|CBM1	0.0	1	829	1	831
ADT70773.1|AA3_1|AA8|CBM1|1.1.99.18	0.0	1	829	1	831
CAP68427.1|AA3_1|AA8|CBM1	0.0	1	829	1	826
CDP31900.1|AA3_1|AA8|CBM1	0.0	1	829	1	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI6_A	0.0	27	829	5	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI7_A	0.0	25	829	2	806	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.01e-318	246	829	1	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1KDG_A	2.12e-119	246	788	1	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
1NAA_A	5.06e-119	253	788	3	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	3.92e-149	11	788	6	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	9.10e-24	253	787	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	1.21e-23	253	787	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|P0DO29|ERIK_HERER	6.13e-23	252	783	33	592	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1
sp|B3PTE0|BETA_RHIE6	6.09e-22	254	787	4	526	Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) OX=491916 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999701	CS pos: 23-24. Pr: 0.9780

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_129729-t26_1-p1.