CAZyme Information: NEUTE1DRAFT_128299-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_128299-t26_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	GL891303|CGC11	73259.25	4.3932

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:811110-813137(+)

Full Sequence      

MIFHHLLGLALAAAPLASAVELIGYEYIVVGSGAGGGPLAARLAMAGHKTLLIEAGNDQG
NNVNVTVPAYSTRATEDEKLSWAFYVRHYPDDEQQARDWKTSYRLSNGTIYTGLSPPEGA
EMLGTFYPRAGTLGGCTAHNALLAVYPFQSDFQYIADLTGDDGWLPDNMRQHFIALEDKN
YPQGGYYGHGQDGWLSIEIPTLTTPDPELLSLVVGGAYALGNATQSPINLTTLATNDLNA
DTIARDHDPSYNEIPISTRNGTRNGSRDFVVAVRDALNPDGSKKYPLDVRLNCFVTKITF
DDTDCDETGEPVATGVEFLDGEYLYRASPLSSSSSSSSSSSSKHARHGGKHANGTPGSAK
ASREVIISGGTYNSPQILKLSGIGPQDELSKFGIPVVVDLPGVGGNLQDHYEISVNVKVP
QDWTVLENCTFLLFDNTTDPCLDRWENPVMGDRGTYASNGVPVVMLYKSSAAEGDDWDLF
TFGGPLNFAGYYPGYSVDLVAEHNWWTWAILKAHPRNRAGTVTLRSSDPLDTPEINFNYF
EYGSGDYQADLTAMREGICLARDALRRSGVCTQEVRPGADTQSDEDLDQYIIDDAWGHHA
SSTCPIGPDGDPMAVLDSKFRVRGVKGLRVVDASVYPKLPGTFTQLSTYMAAEKAACDIL
EGLEDEEVDDGYWRV

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_128299-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	25	661	4e-92	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.14e-61	25	661	8	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.81e-61	25	660	6	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.71e-36	515	655	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.34e-16	25	650	56	567	Protein HOTHEAD
366272	GMC_oxred_N	9.88e-10	125	412	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76690.1|AA3	5.08e-311	7	660	9	641
CDP26593.1|AA3	2.06e-310	7	660	9	641
QMW33146.1|AA3	3.42e-302	1	663	1	645
QRD84722.1|AA3	3.42e-302	1	663	1	645
QMW45179.1|AA3	3.42e-302	1	663	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	2.64e-43	25	656	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.64e-43	25	656	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS2_AAA	2.64e-43	25	656	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.64e-43	25	656	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.26e-43	25	656	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q48CM7|BETA_PSE14	3.00e-42	25	656	7	532	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
sp|A0A248QE08|FAP_CHLVA	3.34e-42	25	656	84	633	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|Q4ZM63|BETA_PSEU2	4.08e-42	25	656	7	532	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1
sp|Q88AE7|BETA_PSESM	8.87e-41	25	656	7	532	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=betA PE=3 SV=1
sp|Q88CW6|BETA_PSEPK	2.91e-40	25	654	5	528	Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000492	0.999479	CS pos: 19-20. Pr: 0.9654

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_128299-t26_1-p1.