CAZyme Information: NEUTE1DRAFT_121136-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_121136-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33426.74	5.5569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:3002067-3003075(+)

Full Sequence      

MVRISLLTYLALGLGSTTVLADCGQAPSSSPSVQIPTGVLTPVTDFGVNPTGLDLHIYVP
KDLAPKPAVILALHLCGGTGPIYSYLSNYNPHADERRSFVVLYPSTPHDNNCWDVASKKS
LTRDAGGDTTSLANMVRWAISEFDADPAKVFVTGSSSGCMMSNVMAAAYPDIFSAVSCYS
GIPAGCLAGSPGASPQNSDPTCGQGKMIKSGEEWAAVLKSIYGKPEGYTEGSYPKVQTWH
GEADFFVNYPNLGEQLKQWSTVLDVPFSKTQANAPDTGYTKIVYGDGSKLVGYSAKGVGH
TVPVHPEEDLKWFGL

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_121136-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	54	216	5.7e-21	0.6431718061674009

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	6.17e-31	58	277	4	212	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.98e-26	6	303	13	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.43e-15	57	186	5	135	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	5.18e-08	52	182	375	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	8.67e-05	136	182	52	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC91056.1|CE1	5.38e-124	43	315	24	292
CAP71713.1|CE1	1.37e-121	26	315	19	321
CDP31104.1|CE1	1.37e-121	26	315	19	321
VBB84349.1|CE1	2.10e-120	26	315	19	319
CAE7030940.1|CE1	1.27e-108	46	315	30	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.01e-83	37	315	1	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HE18|FAEB_TALFU	6.95e-89	40	315	21	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	1.48e-86	40	315	21	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|A2QZI3|AXE1_ASPNC	5.56e-84	37	315	29	302	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	4.47e-83	37	315	29	302	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q92194|AXE1_ASPAW	1.31e-82	37	315	30	303	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000842	0.999114	CS pos: 21-22. Pr: 0.9473

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_121136-t26_1-p1.