CAZyme Information: NEUTE1DRAFT_120847-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_120847-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	GL891303|CGC2	28055.16	9.0665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891303:1687062-1687938(-)

Full Sequence      

MVATIRLLSGLVGSLSFLSLASAEPQVRNDVRIMALGDSITGNPGCWRALLSRKLNATNI
TPPLPYSQIRFVGTQSRTYCGYGSAYDWPHEGHRGYLATDIAQDTVPILGSPVSQPLLQS
WLTAPGVAPVDIILMHLGTNDIWQNRTAIQIINAYGQLLDQMRAVNPNIRLLPANCPECA
AKVRMLNRYISIWAQYVTRQQSPVVAVDLYSGFNATRYTTDGVHPNARGDEAIATGWVGA
VIRSVRDVLAQRDVRV

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_120847-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	31	240	1.8e-49	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.08e-32	31	241	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	7.73e-14	35	229	1	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238866	sialate_O-acetylesterase_like2	9.16e-11	131	241	50	164	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	4.09e-09	131	234	67	181	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	8.14e-08	131	240	63	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI05234.1|CE3	9.49e-55	21	252	51	268
QOC93127.1|CBM2|CE3	3.12e-54	19	248	44	254
AEB43376.1|CBM2|CE3	6.02e-53	17	248	36	253
AUS81639.1|CE3	3.21e-52	21	241	29	237
BCJ58010.1|CBM2|CE3	3.49e-52	20	248	39	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	1.27e-24	31	248	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	3.49e-24	31	248	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.09e-08	5	238	15	257	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000358	0.999614	CS pos: 23-24. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_120847-t26_1-p1.