CAZyme Information: NEUTE1DRAFT_116758-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_116758-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	GL891304|CGC1	43561.40	4.7680

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891304:221241-222488(+)

Full Sequence      

MRASELLAGAAALLASGVSAEAYLGFNSGNTLPSREAKFKKDWVQEFTTAQNLKNSPGVF
NAVRLYTNIQAYSQTSEPIEAFEAAIETNTKILLGVWASGTNTIEPEIKALQNGIAKYGK
KLTDLIIGASIGSEDLYRVSVTGIQNKSGVGAGPAELVKFISDWKKAFQGTAIANVPIGH
VDTWDAWTNGTNKPVIDAVDWVGVDEYPYYENGKGNNIENSGYLFDRAYDAIEGAVGGKP
IWVTETGWPYVGQTWDQAEATIKNQQYYWQEVGCRKLFGKVPTFWYNLRDSNPDNEMKFA
ITDNLSTTPHFDLTCPKTFKTTPKASSSSASATSAATGTGVSSPSSMESGSSGSGSSGSG
SSGSASSGTASSSEPATVTAPAESAVATGSATSVKGVSAAAVAGMTLLVGVFAML

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_116758-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.64e-20	61	274	77	267	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.73e-09	24	292	1	283	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA29849.1|GH17	1.08e-266	1	415	1	410
AEO57324.1|GH17	2.59e-170	10	321	9	319
CDP32718.1|GH17	5.21e-170	1	414	1	404
CAP65657.1|GH17	5.21e-170	1	414	1	404
VBB87201.1|GH17	5.21e-170	1	414	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.27e-16	49	290	51	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.39e-15	49	290	51	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QH21|EGLC_ASPNC	1.89e-88	19	315	16	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglC PE=3 SV=2
sp|Q2UUZ1|EGLC_ASPOR	2.28e-87	1	329	1	322	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	3.15e-87	14	315	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	4.40e-86	14	315	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	4.93e-86	14	315	11	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000534	0.999432	CS pos: 20-21. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_116758-t26_1-p1.