CAZyme Information: NEUTE1DRAFT_111609-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_111609-t26_1-p1
• CAZy Family: AA13|CBM20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
600		68081.75	6.8355

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891306:364669-366471(-)

Full Sequence      

MARFSSTGSIIPRGYLRPKSRRRHIFLLALLLLFSIAYFLHSSSSSSSPSSAHAVSEFAW
LEHHMNSPFPSLTKLISNTSFDWNSVPYKYPPPFPLRHLPLPINSSPSLPPIQHHFPPES
RAARKLRESRRQQVKKVFIKNWNSYRTLAWKKDALLPISGGYKDQFSGWAATLIDSLDTL
WIMGLRREFDEAVDAVADIDFGTVKEGSGRVNTFETNIRYLGGLLGAYDLSQREFLLIKA
KEVGDLLFAGFNTATRMPVDFIDFERAKEGKEGLEVEESVVSASPGTLTLEMTRLAQVTG
DMKYYDAAARVMDVFERGQNRTKIPGLWPVYVSMARQDVVTSGNQFGVAGGADSLYEYLP
KMYALTEGMETRYESMSRAFLEAADEKLFYRPMVPGNEDVLMIGTADVIVDTDGKEEMVL
NPESEHLGCFLGGVYGLGGRLFGRLEWVENQGVKITRGCVYAYRAMPTGMMPERYNMVPC
PSRDDASCRWNEEVWEREKKKRLEWKQHLPKGFTTAKDPRYILRPEAIESVFVMWRITGR
QEFQEAAWDMFTAVSNGTETEFANAAVLDVTKAEYPLPKEDYMEVRVLLTLTRYDAGFKQ

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	138	588	1e-123	0.92152466367713

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.83e-162	137	584	1	416	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.22e-96	76	570	18	469	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.004	116	315	382	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA29739.2|GH47	0.0	1	594	1	563
UQC90072.1|GH47	2.28e-218	53	594	34	562
UPM17948.1|GH47	4.42e-215	56	594	35	560
UKZ71903.1|GH47	4.11e-211	49	594	30	561
QYT04436.1|GH47	4.56e-210	49	594	29	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	1.82e-47	121	573	31	456	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	2.45e-47	134	573	9	421	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
5KIJ_A	5.28e-41	130	580	5	410	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	5.57e-41	130	580	5	410	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	5.88e-41	130	580	10	415	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	3.75e-49	126	573	35	455	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|Q2ULB2|MNS1B_ASPOR	3.71e-48	106	573	17	456	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	3.71e-48	106	573	17	456	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|B0XMT4|MNS1B_ASPFC	9.81e-48	129	570	31	445	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mns1B PE=3 SV=1
sp|Q4WRZ5|MNS1B_ASPFU	9.81e-48	129	570	31	445	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000013

TMHMM  Annotations     

Start	End
25	42