CAZyme Information: NEUTE1DRAFT_105586-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_105586-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: chitinase 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46391.36	7.7915

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891382:4969900-4971355(-)

Full Sequence      

MLSSFITCVIPLLVISTPAAAATSQFQIQSAGNTTVSSYRNAVYFTNWGIYGANFQPQQL
PASQITHVLYSFADIKPDGQVALTPSRVSSDTYADLEKHYPGDSWSEPGENVYGCVKQMY
LLKKRNRNMKFPPVAATEEGRRRFASSAVKLVQDWGFDGLDIDWEYPTNAREAQDFVLLL
RACRQALDDYARQYAPGYHFLITIAAPAGPQHYGVMDLPGMNPYIDSWHLMAYDYTGSWD
STTGHQANLLPSPKNLLTTRFNTDQAVRDFVRRGIPANKIVLGLPLYGRSFEDTDGLGKP
YSGIGAGTLEPGTWVYRDLPRPGAKEEYDNLAKATYSYDASSRELITYDNVLSALVKTKY
IFLRGLGGAVFWEASGDKAGAKSLIGTLATQMKRLDQTKNLLAYPASRYANIRAGVPES

Enzyme Prediction     

EC	3.2.1.14:58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	38	383	3.7e-69	0.9594594594594594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.01e-115	41	377	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	3.68e-106	40	377	1	334	Glyco_18 domain.
395573	Glyco_hydro_18	5.98e-78	40	377	1	307	Glycosyl hydrolases family 18.
225862	ChiA	1.89e-77	34	389	33	433	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	3.81e-72	44	372	4	336	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA36073.3|GH18	3.83e-297	1	419	1	426
AEO70479.1|GH18	7.78e-184	30	417	91	488
QBZ56002.1|GH18	4.52e-173	14	408	95	496
VBB72338.1|GH18	5.84e-169	28	417	101	501
CCD33599.1|GH18	2.33e-163	19	417	24	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D2K_A	9.37e-150	39	417	3	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	2.67e-149	39	417	3	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	5.37e-149	39	417	3	391	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	1.26e-147	37	416	36	422	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	1.66e-145	37	416	36	422	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	1.05e-150	37	416	36	422	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|Q1E3R8|CHI1_COCIM	1.60e-148	39	417	38	426	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	1.60e-148	39	417	38	426	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|C5P230|CHI1_COCP7	3.21e-148	39	417	38	426	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
sp|E9ERT9|CHI1_METRA	1.34e-146	39	413	39	420	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000416	0.999539	CS pos: 21-22. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_105586-t26_1-p1.