CAZyme Information: NEUTE1DRAFT_100267-t26_1-p1

Basic Information

• Species: Neurospora tetrasperma
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora tetrasperma
• CAZyme ID: NEUTE1DRAFT_100267-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519	GL891304|CGC16	56286.27	5.2102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NtetraspermaFGSC2508	10380	510951	0	10380

• Gene Location: location=GL891304:476157-477716(+)

Full Sequence      

MHLIEVLELDAGSGIPLETVGSAYTPQGSEQGDESSLDDSDYDDLFSDEDEDMRDLESDT
DPEDDESVLDGVPPEVTIPQAQLDSILGQMAVIVPCKGEDPNTIEGVLSGIPRGCLIVLV
SNSEGRAYRKEVMMLRKFCRHARPALAIHQSDAAAAAAFNMYGLPDLVTHVAGGSHKRIR
NGKGEGMMLGIALVAALCPQRRYVAFVDADITVPGAVNEYCRAFAAGFALNPNPGTETMV
RLRWASKPKVRNGEIDYTCEGRSSQVVNRWLNKLLSAMADADPTGSLAAARDSEIIVTGN
AGEHAMTMDLALSLRLANGYAIEPFHFVELLDQLAPQNAAAAAAAAAGAHAGYNAGRVPN
LQPVTIMQIRTRNPHFHRVTDDSHVRSMWASGLGSIYHHLPASLNNSTTQTPSPPSSAAF
SSSSSSKSFARGEKLRGDILDFLADNHEENDNSKGELVHEPPRPRIYPPVRQLDLDGFRE
MVRSEHKTLYCLNLPHFKLPRPNTIAPVYHHQYGVTPPL

Enzyme Prediction     

No EC number prediction in NEUTE1DRAFT_100267-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT55	56	482	3.7e-150	0.9425587467362925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401440	Osmo_MPGsynth	1.70e-170	51	482	15	380	Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth). This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP) EC:2.4.1.217, comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
237735	PRK14503	3.70e-94	54	491	22	390	mannosyl-3-phosphoglycerate synthase; Provisional
162866	osmo_MPGsynth	6.09e-83	69	483	25	381	mannosyl-3-phosphoglycerate synthase. This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together mannosyl-3-phosphoglycerate phosphatase (MPGP) comprises a two-step pathway for mannosylglycerate biosynthesis. Mannosylglycerate is a compatible solute that tends to be restricted to extreme thermophiles of archaea and bacteria. Note that in Rhodothermus marinus, this pathway is one of two; the other is condensation of GDP-mannose with D-glycerate by mannosylglycerate synthase.
184713	PRK14502	3.23e-58	78	490	45	393	bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57250.1|GT55	1.08e-91	83	482	141	611
AEO69746.1|GT55	1.28e-90	83	482	116	527
QBZ63715.1|GT55	4.18e-84	69	475	84	432
VBB87296.1|GT55	5.63e-82	82	482	77	435
CAP65753.1|GT55	1.56e-81	82	482	77	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WVK_A	8.40e-57	81	484	46	383	Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVK_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 apoprotein [Thermus thermophilus HB27],2WVL_A Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVL_B Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]
2ZU7_A	1.31e-55	78	489	41	389	Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU7_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU8_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_A Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii],2ZU9_B Crystal structure of mannosyl-3-phosphoglycerate synthase from Pyrococcus horikoshii [Pyrococcus horikoshii]
2WVM_A	2.38e-55	81	484	46	383	H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27],2WVM_B H309A mutant of Mannosyl-3-phosphoglycerate synthase from Thermus thermophilus HB27 in complex with GDP-alpha-D-Mannose and Mg(II) [Thermus thermophilus HB27]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8U380|MPGS_PYRFU	9.58e-62	78	489	41	389	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mngA PE=3 SV=1
sp|O58689|MPGS_PYRHO	7.23e-61	78	489	41	389	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=mngA PE=1 SV=1
sp|Q9UZC1|MPGS_PYRAB	7.61e-60	78	489	41	389	Mannosyl-3-phosphoglycerate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=mngA PE=3 SV=1
sp|Q9YDM5|MPGS_AERPE	1.08e-32	69	470	26	365	Mannosyl-3-phosphoglycerate synthase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) OX=272557 GN=mngA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000006

TMHMM  Annotations     

There is no transmembrane helices in NEUTE1DRAFT_100267-t26_1-p1.