CAZyme Information: NEUDI_97756T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_97756T0-p1
• CAZy Family: GT50
• CAZyme Description: Predicted endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
918	NdisFGSC8579_SC006|CGC3	97847.21	7.1798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC006:159696-162529(+)

Full Sequence      

MAVTTPTVAASPSYSSPPYKGSGNKPSPVFFSSSRPFSSKGYSHQQPPQTKGDADNSTTK
PSNGDLFSTPISPDLSIPQSIPSQPNHPAPRTGIKQSQEGNRTAIPTNKFHANFFLGSQS
SSVWTHPYSLQWAKGQGSSSAWGLAVSHTNASQRFFGEPDPSGSGAARWFGNPLGRADVV
LSERELEKGNATGGVELMTQDIKEQSVRVQLVAGGDVKLEAPVVQGMGMVTALYKQGTPV
IKSGIGWKMVTKAVGVVKAGVVKYRLVMEDGATWLLYATGGDVSAIKRGEPGGLELEVQG
NNVAVAKGSFTGMLQVAKLPGGSANGTEGVADAEKLYDAACGTYATGVELSGSVDGPKGR
YTFSFQTEGLSTNSSLVMFALPHHQASFSSDTASKVVSSVKLDTTTKGVAVAVVGDSWTM
EEEVSKPMSIGFVPWTPEAGSAKNISDSAKELIKTIAQQELLGTSQGQGILSQTDQPSMY
YGGKALAKFASILVAVNDVLGETDLAKKGLELLKVAFARYSDNQQQYPLAYDQSWGGLVS
SASYTTGDSGADFGNTYYNDHHFHYGYFIYTGAVLAHLDPTWASSASNLAYVNSLVRDVA
NPSSSLDPHFPSFRTFDWYHGHSWAHGLFEASDGKDQESSSEDSMHVYALLMWAQATNNQ
ALYQRSALQLSLLSRSLNSYYLYSSSNPSSQIQPKEFVGNKVAGILFENKIDHVTFFGNK
KEYIQGIHMLPLLPHTLFVRNKEFVKEEWEAFFAGGEADKAEGAWKGVLYGNYATIDPRG
AWDVFTGASGVPPGGSQLADQGRGSWNGTSGTGTGEPTTGNATATPTSTSEPTTPGGISS
KMVRRTIRRALDKGKGKMGMPLTRASLPKAKRDGGFSHENIDGGASLTWYLTWCAGKLSL
LALVCFFSGWDGANSGTR

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	94	786	4.6e-212	0.9517684887459807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	41	785	37	729	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	444	786	1	330	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.84e-116	87	437	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA31105.1|GH81	0.0	1	895	1	907
AEO64126.1|GH81	3.12e-254	65	786	168	847
VBB80051.1|GH81	1.35e-243	66	787	253	929
CAP66697.1|GH81	2.97e-243	66	787	253	929
CDP28432.1|GH81	2.97e-243	66	787	253	929

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.45e-81	62	782	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.34e-81	62	782	28	719	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.45e-79	62	782	3	694	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.89e-27	473	799	330	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.39e-25	480	750	361	624	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.40e-194	65	785	192	876	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.51e-142	66	789	7	680	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.28e-133	74	786	53	712	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	1.64e-127	66	786	75	753	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.87e-125	105	786	434	1086	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000002

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_97756T0-p1.