CAZyme Information: NEUDI_94248T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_94248T0-p1
• CAZy Family: GT34
• CAZyme Description: Mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		49442.52	9.8904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:2652111-2653579(-)

Full Sequence      

MADPSSRPKSNPPLYEQALGFALDVANGRHALSKLIPPALFLADALLCGLIIWKVPYTEI
DWTAYMEQVSQILSGERNYTKIRGGTGPLVYPAAHVYIYTGLYHLTDEGKNILLAQKLFV
GLYMATLAVVMGCYWQAKAPPYLFPLLILSKRLHSIFVLRCFNDCFAILFLWLAIFFLQR
RNWQVGALLYTLGLGVKMTLLLSLPAVGLILFLGSGSFVTTLQLVATMGLVQILIGVPFL
AHYPTEYLSRAFELSRQFFFKWTVNWRFIGEETFLSKGFALTLLALHVLVLGIFVTTRWI
KPARKSLVQLISPVLLAGKPPLTGPEHRAAARDVTPRYIMTTILSANAVGLLFARSLHYQ
FYAYVAWSTPFLFWRAGLHPVLVYLMWAVQEWAWNVFPSTPASSAVVVGVLGVTVAGVWL
GAREEWEPGMKSSSKKEEAAMR

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	38	404	2.1e-150	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	38	404	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAK07848.1|GT58	7.68e-307	1	442	1	442
AEO60805.1|GT58	1.01e-229	11	428	19	434
AEO66311.1|GT58	1.37e-222	12	442	5	445
VBB84570.1|GT58	5.49e-199	12	423	6	415
EHA55153.1|GT58	1.48e-197	12	437	6	429

PDB Hits     

NEUDI_94248T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.36e-307	1	442	1	442	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	6.06e-151	27	423	13	396	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	5.00e-144	27	418	75	453	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	1.38e-143	27	418	21	399	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	2.58e-139	27	418	13	391	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000006

TMHMM  Annotations     

Start	End
35	57
119	136
156	178
191	213
218	240
278	300
337	359
371	390
400	422