CAZyme Information: NEUDI_93909T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_93909T0-p1
• CAZy Family: GT8
• CAZyme Description: Predicted membrane protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895		97416.79	8.5237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:2110477-2114223(+)

Full Sequence      

MSLSQRPPSSALLSASKDVDDNSVQPRNRRVAGNRNNATPSSLYSSPSRTPDRGASPIPA
PRIGDVTGRNNSRLEVAAGSARASSPRGGRGLLDGSWASTWASVQEFTTSLLTGGESYHT
GPERSATRSAVKQKSSSSSWGPEPPNESRPRLEDVGLGSLTEREGRLRALRTASVLESHE
GVNGGLDVSRRFKKRNSDEDLREASQSQETAEHLVYIHHVQPTDTYAGIVLRYRCREDAF
RKANGLWSRDNIQIRKWLAIPVDACEIKGRPCEGPSFSGAQVDYLARTPEGTDPFGRDDT
KNREFFGSSTNDRGGDNRLPTNDDERPWTHVRWVSLDSFPNPVEVARVERKVLGYFPPRR
RKSINTTSTMTSPRTSMDVPATTLSGETGPVSPGCISSRRTSLMGNRPSLIGDDTRPAWM
RRPGGVGSLRNVRAPGPEKDYFNTWTNKHLPGLNIDSLPSMAVLGAETARLGFHGAEEHP
TIVESPFEDGGDASRINGQGSTSLDKAAAAVENWLRGAFVKRPLGTPSLGVPKRSPLGAE
EGDLIELTDTNSDDDRGGTVNPTSSEIQDTRLLNPEAGTSGRSVTMGGTLPLLSLAVRMP
ICIECRHPVKTLWREGAGDKSTGHNIRLTVCKNCGRFCDKYVEHDFVVLFIDLVLIKPQV
YRHLLHNTLMKDEDEFAPSIIRLGVLLLLFDVYLTWARIEKQSAPAINSVDGTASSSMNS
ASISNFGRLAQQPIVLQYMFFLLLCTLSTLAFHGSIRFLTSSRYSPLYLLGILPQFSRPN
SVSTALLVSSSTKLFPILMVIWEYDVPAAARSLGWAVVANNVEALKILLDCNYGVATLLA
TAGALSRWAMGRAVLWAAGLDGVDSVGEHSVAEEGKVLGSLLMYAKDWLGRLAVG

Enzyme Prediction     

No EC number prediction in NEUDI_93909T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398023	Arv1	7.78e-93	601	825	1	205	Arv1-like family. Arv1 is a transmembrane protein with potential zinc-binding motifs. ARV1 is a novel mediator of eukaryotic sterol homeostasis.
227579	ARV1	1.84e-34	601	828	2	218	Predicted membrane protein [Function unknown].
212030	LysM	1.99e-04	217	260	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB83868.1|CBM50	6.13e-186	1	583	1	610
QBZ56316.1|CBM50	4.15e-171	9	556	3	598
UQC89347.1|CBM50	1.89e-162	93	593	90	620
CEI65780.1|CBM50	4.29e-147	9	588	14	624
CZS77411.1|CBM50	4.71e-146	9	588	14	624

PDB Hits     

NEUDI_93909T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CY38|Y2072_EMENI	5.80e-46	12	549	24	566	Uncharacterized protein AN12072 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN12072 PE=4 SV=1
sp|Q9HDX5|ARV1_SCHPO	8.27e-34	602	828	3	199	Protein arv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arv1 PE=3 SV=3
sp|Q54GD9|ARV1_DICDI	2.97e-23	601	830	2	209	Protein arv1 homolog OS=Dictyostelium discoideum OX=44689 GN=arv1 PE=3 SV=1
sp|Q5ANH2|ARV1_CANAL	1.43e-20	601	833	2	240	Protein ARV1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARV1 PE=3 SV=1
sp|Q750Q7|ARV1_ASHGO	5.03e-20	601	839	2	248	Protein ARV1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ARV1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000001

TMHMM  Annotations     

Start	End
734	756