CAZyme Information: NEUDI_84567T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_84567T0-p1
• CAZy Family: GT2
• CAZyme Description: Subunit of Golgi mannosyltransferase complex

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		35887.11	9.6307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC011:577450-578592(-)

Full Sequence      

MHFAYPPRKSSNPPPFRPRTSALPTIRGKRLKAIVLSGLAFLTLLWLFHRGGRNRHAPPA
YHKPSGNPPVVIVTVFNEGKYGKGYLDMVKENRLKYAEKHGYGTFFVKSSDYDLRGAPVS
WATLPAVRHAMTKFPDASYIWYLDQNAFIMNPLLKIEEHVMKPSRLEELMIKDHPVVPPD
SIIKTFSHLKGHDVDFVLTQDKDGLSSSSFVVKNGEWAKFFIETWFDPIYRSYNFQKAEQ
HALEHIVQWHPTILAKLALVPQRILNSYSKEKGGQEYKEGDLAVRLYACGEAGEDTCETE
SQRFAQWKAAHQDS

Enzyme Prediction     

No EC number prediction in NEUDI_84567T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	68	294	6.5e-82	0.975609756097561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.11e-107	66	295	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	1.20e-05	92	159	156	226	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF58113.1|GT34	5.17e-229	1	314	1	324
CAB91762.2|GT34	5.17e-229	1	314	1	324
VBB77835.1|GT34	1.82e-155	1	310	1	309
CDP27323.1|GT34	3.74e-149	1	310	1	304
CAP70731.1|GT34	3.74e-149	1	310	1	304

PDB Hits     

NEUDI_84567T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	6.90e-44	85	306	88	308	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	7.19e-37	85	289	123	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	7.38e-36	85	314	123	356	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	4.55e-35	48	289	71	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|P46985|MNN11_YEAST	4.37e-32	56	300	146	411	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999990	0.000015

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_84567T0-p1.