CAZyme Information: NEUDI_75337T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_75337T0-p1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	NdisFGSC8579_SC003|CGC8	41894.05	6.0930

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC003:1738764-1740124(-)

Full Sequence      

MYQLSRLAALAATLSTVMGAYQGFNYGSSFTTGTAKQQSDFEAEFRTAQGLVGAPAGGFT
SARLYTMIQGGTVNAPISAIPAAIATRTSLLLGLWASAGDAAFTNELQALSSAIQQYGTA
LGGLVAGISVGSEDLYRISPTGIENKENPGAAPLTIAHYIKQVRDIIARTALDGVPVGHV
DTWTAWVNSSNQVVVDASDFLGFDGYPYFQKTQQNDIGHSKSLFNDALSATKAASQGKPV
WITETGFPLSGKTMGQAVPSIANAKYYWDQVGCPLFGSTNVWWYTMQDSAPTTPNPSFGL
IGSTLTTTPLFDLSCNSSKLGQTASSSISLPSGVNIALSQSEVSTASSAITFLAPVSSLA
SNGTTTVASLPSGTSTATNSGKASSIKGSMGNAIAVVVMAMALLGH

Enzyme Prediction     

No EC number prediction in NEUDI_75337T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.56e-23	23	277	47	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.96e-06	180	315	157	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC89650.1|GH17	2.02e-141	7	316	5	313
UNI21974.1|GH17	1.15e-136	7	316	7	315
UKZ85392.1|GH17	1.34e-136	5	332	5	331
QYS93923.1|GH17	1.19e-135	5	315	5	314
UKZ59928.1|GH17	7.14e-135	5	331	81	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.17e-13	74	273	78	252	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.29e-12	74	273	78	252	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DJ47|EGLC_NEOFI	3.92e-136	3	332	2	325	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q4WG16|EGLC_ASPFU	1.12e-134	3	319	2	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	1.28e-134	3	319	2	314	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	3.91e-134	3	327	2	322	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|Q0C7P6|EGLC_ASPTN	1.80e-127	3	331	2	325	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.270674	0.729301	CS pos: 19-20. Pr: 0.6954

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_75337T0-p1.