CAZyme Information: NEUDI_71911T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_71911T0-p1
• CAZy Family: GH72|CBM43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975		110104.02	6.6264

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC001:3505502-3508610(+)

Full Sequence      

MKAFRSYFTPSSTAAARDNGRATRKSDEDNRLPEQRREKLSGQTTTGPSSSPATYDGSAV
TPRSITPSPMPGDMLTVPGAAHYGPRRQIGQLTASAAGSTYSFRNSIFPVGDARNGDSDA
MTEIRSDMMVNSLFEQMCRKQYSTGFDPYEGVVLKKSRGNFTCCPPQMAAIPDSLYVMIT
QMNVRCAMTINTHVVRTILDGIGRRNDVNFVPLPDGLRVQILRTMSDLPKGQLHQFAAFI
EDAKILVVWADEPEKILSWAENLEKKLIESIWGTNNDADDDDADEKGNATTQIEEVDGSS
LEQAKEHRPVRLESAFIVALTMALCVACLGLGWRALAYEASMDKSYVRFALLAVTPIQFF
VSLVRMFQYFFFQSLAGNLFQIFGPISSVENNSKYYSGKPPQRLDRHQHALPHVTFQMPV
YKEGLAAVIKPTVVSVKQAISTYEMQGGTANIFVNDDGMQLVSEEEARARRDFYDEHNIG
WVARPPHKPKPNLEAGETVFLRRGKFKKASNMNYALHTSNRVEEKLTKINRIGNWTNDYE
TAAYQQCLNEVLREDEGRTWAEGNIRVGDYILLIDSDTRVPSDCLLDAVSEMEQSPEVAI
LQFASGVMNVSDSFFEKGQVKSCISLVSCRRELMADRFRLRSVTWFTNLIYTAITFAVAC
GDACPFVGHNAMLRWQALQDAASYEEDGYEKYWSESHVSEDFDMALRLQCAGYSLRYASY
TGEGFKEGVSLTVYDELARWEKYAYGCNELLFHPLRFWVIHGPFTPLFRKFLGSGIALPK
KLTICAYIGTYYAIGAAWALSLINYFLTGWYEGFYDKYYLDSFAIYCAIIVVFSALGNCA
LAILRYRTNKQGLFTGFIDNLKWIPMFTIFLGGLSIHVSQAILCHFFEIDMVWGATAKEI
EEVHFGQEIIRILKRFKFTFLYCFLMTGLIVAGWFFFPHPWKIQKLYSVYPLASMAVTHF
ALPVLLNPALMLFTW

Enzyme Prediction     

No EC number prediction in NEUDI_71911T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	570	809	5.5e-46	0.9746192893401016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.61e-44	570	800	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.77e-09	568	901	138	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.04e-07	418	701	3	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133029	GT_2_like_c	4.69e-06	550	718	52	157	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
132997	Glyco_tranf_GTA_type	7.67e-04	568	608	78	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD36996.1|GT0	0.0	1	975	1	953
EAA31611.3|GT0	0.0	70	975	1	877
VBB76138.1|GT0	0.0	1	975	1	941
AEO63469.1|GT0	0.0	1	975	1	981
AEO56958.1|GT0	0.0	57	975	62	956

PDB Hits     

NEUDI_71911T0-p1 has no PDB hit.

Swiss-Prot Hits     

NEUDI_71911T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000002

TMHMM  Annotations     

Start	End
315	337
349	371
787	809
822	844
864	886
918	937
952	974