CAZyme Information: NEUDI_62093T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_62093T0-p1
• CAZy Family: GH64|GH64
• CAZyme Description: Dolichyl-phosphate-mannose:protein O-mannosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	NdisFGSC8579_SC007|CGC7	85641.51	9.3249

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC007:1964018-1966475(+)

Full Sequence      

MASTTATPEATLRQRNVPASKKAKNGGSSDVETDKIPDAVAPTKSGSELEYKLALVLITG
LAFLTRFWGISHPDEVVFDEVHFGKLLFAFMGWMVGYDGHFHFENIGDSYIRNKVPYVAF
RSLPAILGALTVSVVYMIMWESGYSLPACLIAAGLVLLDNAHIGQTRLILLDATLVFAMA
CSLLCYIKFHKLRHEPFSRKWWKWLILTGFALSCDISTKYVGLFAFITIGSAVCIDLWDL
LDIKRPGGALTLPQFGKHFAARAFGLIIMPFIFYLFWFQVHFSILTRSGPGDDFMTPEFQ
ETLSDNIMLANAVTIDYYDTISIRHKETKAYLHSHPDKYPLRYDDGRVSSQGQQVTGYPF
NDTNNYWQILPPGPDDQKLGHHIKNHDLVRLRHIVTDTILLSHDVASPYYPTNQEFTTVS
IGEAYGDRAADTLFEIRIEHGKANQEFKSISSHFKLIHNPSKVAMWTHSKPLPEWGHKQQ
EINGNKQLAQSSNVWLVEDIVSLPADHARREKPEKKVKTLPFLRKWFELQRSMFWHNNQL
TSSHPYASLPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIGWWLASSVLAIYAGIVLADQF
SLRRGLDAMDRRTRSRLYNSTGFFFLAWATHYFPFFVMGRQLFLHHYLPAHLASALVTGS
VVEFLFSTDSAEPGYQPSKSGKKVAPTTKRRLSARERLAGQSMAGAWIATAVIMVLVAFG
WYFFLPLTYGYPGLTAPEVNRRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	83	282	2.3e-47	0.7847533632286996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	37	753	9	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
406576	PMT_4TMC	1.72e-79	524	745	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
396786	PMT	1.54e-66	56	286	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
397103	MIR	4.00e-19	333	482	13	170	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.26e-07	317	372	6	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO54171.1|GT39	0.0	5	753	4	775
AEO65833.1|GT39	0.0	5	753	4	777
CDP23606.1|GT39	0.0	5	753	3	773
CAP69590.1|GT39	0.0	5	753	3	773
VBB72720.1|GT39	0.0	5	753	3	772

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	6.11e-90	49	667	47	676	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	6.84e-78	9	742	20	743	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	1.33e-06	318	497	10	174	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	2.21e-233	30	753	27	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	1.41e-229	16	745	31	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.02e-222	48	753	49	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	3.66e-101	49	650	35	669	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	5.47e-100	49	650	35	669	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999832	0.000169

TMHMM  Annotations     

Start	End
53	70
80	97
118	140
168	190
220	239
259	278
573	595
615	637
703	725