CAZyme Information: NEUDI_61975T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_61975T0-p1
• CAZy Family: GH64
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		48526.35	6.4986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC007:1372234-1373931(-)

Full Sequence      

MWCLSELAVFGLGFLSASATILQNGQPRITNFPDTRIDPSSYSFNTYPRNASEISYKGRW
DSRYVSWWSAPGIKFGYTGQIVAVTFGNWTSDGVLVGYRISGLDWIFTNITAGGTHLFVS
PETPGSDLTAPISPSVLELRVTNWAYGIQIESVHVAKGEKLIRIPDYGRRIEIIGDSLAS
GMYTSYEGLSSWAYGLGAGLGNTEYSITAYPGICAADQNCWGNPHGQVHQWFYTSDTSHR
ASVMYGDNPEPWDFSKRPAADIVVINIGTNDQNSHNNVSTTIYIDALTRIIQGIHGKWPK
AQVVVMSLWLGFYQSGNTYLPNAPQGFVNEIYHMYKWFNSDDYLRNPIVYDGVTNKRRKT
GKRTKPFVHYFNTTGIMQHNDIGPQWHPTDIGAIKVASNLQQFIKMTFGWELYATGPEVF
HETEYWNDEPGY

Enzyme Prediction     

No EC number prediction in NEUDI_61975T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	170	404	6.4e-18	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	6.00e-31	170	405	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	2.46e-08	171	403	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	9.43e-08	173	312	1	112	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238874	FeeA_FeeB_like	4.14e-07	169	305	3	111	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	0.002	259	400	78	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35351.3|CE0	0.0	1	432	1	432
AEO54717.1|CE0	2.98e-274	5	432	5	433
CDP24093.1|CE0	2.17e-263	1	432	1	436
VBB73265.1|CE0	8.84e-263	1	432	1	436
CAP67836.1|CE0	2.04e-247	1	432	1	435

PDB Hits     

NEUDI_61975T0-p1 has no PDB hit.

Swiss-Prot Hits     

NEUDI_61975T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003904	0.996064	CS pos: 19-20. Pr: 0.9247

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_61975T0-p1.