CAZyme Information: NEUDI_58245T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_58245T0-p1
• CAZy Family: GH55
• CAZyme Description: Glycosyl transferase, family 8 - glycogenin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	NdisFGSC8579_SC005|CGC4	35402.59	7.1882

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC005:1570606-1571713(-)

Full Sequence      

MAVDYPTNMIWSTLVTKRAYLGGALVLNHTLKKVGSRYQLKIMVTREAAADKELMAAFAA
AGIPTIVIETIEPTRKGKVNKAFWQKLAPWAMTEYERIVLLDSDQVILQNIDHLMTLHLP
EGHIACSHACTCNPRKIAHYPKDWIPQNCPFTSANHHTGSPAPITSSSPRTHHLLNSGTV
VLTPSKPQFDALIDAINTHPDVPHMVFPDQDILAIVYRGKWTPLPYVYNALKPMRDCHSS
LWRDEDVKVLHYILNKPWESRDFDINDKVESTHRLWWEAWEEVEREWTGADAGEEKRRLF
DSVLRSVVAQG

Enzyme Prediction     

No EC number prediction in NEUDI_58245T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	13	260	1.8e-39	0.8638132295719845

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.21e-71	9	282	1	239	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
215090	PLN00176	1.08e-16	20	282	35	293	galactinol synthase
279798	Glyco_transf_8	3.52e-11	20	258	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	2.62e-10	94	258	95	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
133064	GT8_GNT1	1.49e-09	11	196	3	150	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR43371.1|GT8	1.76e-73	2	290	4	295
QRW25818.1|GT8	9.38e-70	5	291	4	305
AOR51685.1|GT8	6.37e-69	11	288	9	289
QRV98890.1|GT8	3.97e-68	1	285	1	299
QRW13438.1|GT8	3.16e-67	1	285	1	299

PDB Hits     

NEUDI_58245T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XGN4|GOLS1_AJURE	3.65e-17	20	295	35	308	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O80518|GOLS3_ARATH	1.28e-16	20	278	28	283	Galactinol synthase 3 OS=Arabidopsis thaliana OX=3702 GN=GOLS3 PE=1 SV=1
sp|Q9FXB2|GOLS2_ARATH	2.84e-15	20	298	34	309	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|Q9XGN3|GOLS2_AJURE	3.03e-14	31	267	7	240	Galactinol synthase 2 (Fragment) OS=Ajuga reptans OX=38596 GN=GOLS2 PE=1 SV=1
sp|Q8H1S1|GOLS6_ARATH	3.32e-14	14	311	31	325	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_58245T0-p1.