CAZyme Information: NEUDI_42347T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_42347T0-p1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33078.06	5.7268

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC008:938749-939651(+)

Full Sequence      

GITYAPYDLTGCRSPANITSDFAAIAKTGLYSSVRIYGVDCSQVLNTLRAASSVSPPLTL
FLGIFNLSDLSSQITTLVKDVQTFVATSPPSQRITVGDVWNNMIDTISVGNELVNNGQAT
PAQVLAAVRTVREVLRREGYQGPVVTVDTFVAVLQHPQLCSSPDTDYCAVNIHPFFDPHT
DADQAGNFVRRQVLNLRETITPKSQQANDTKGGGGAKQEKRVVVTEVGWPKQGNANNRAV
PGRPEQQRAVEGVMKVWREGRERGFADDGDFEMYLFTAFDDEWKKADKGTFYAEQFWGLH
N

Enzyme Prediction     

No EC number prediction in NEUDI_42347T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	22	300	5.1e-28	0.9003215434083601

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.84e-50	1	301	47	302	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	9.64e-07	14	299	14	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI63520.1|GH17	6.05e-68	1	299	82	333
QGI80797.1|GH17	6.05e-68	1	299	82	333
QGI94402.1|GH17	6.05e-68	1	299	82	333
CCT67472.1|GH17	6.05e-68	1	299	82	333
QKD49574.1|GH17	8.18e-68	1	299	105	356

PDB Hits     

NEUDI_42347T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	5.50e-53	1	301	128	377	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	4.60e-50	1	299	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	9.79e-48	1	299	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	3.83e-29	1	298	304	553	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	5.43e-29	1	298	310	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999296	0.000721

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_42347T0-p1.