CAZyme Information: NEUDI_23402T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_23402T0-p1
• CAZy Family: GH47
• CAZyme Description: Neutral trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653	NdisFGSC8579_SC004|CGC3	73168.44	4.9542

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC004:1974121-1976330(+)

Full Sequence      

MVSRLLGATVPLAAAILPGARALPTIKPVDEVLEAFSKLTLPLSNNSELHEFLSTYFGPA
GGELEAVPTDQLHVSPKFLDNVSDDVIKQFVDSVINIWPDLTRKYVGAGESCTGCANSFI
PVNRTFVVAGGRFREPYYWDSFWILEGLLRTGGAFTEISKNTIENFLDLVEQIGFVPNGA
RLYYLDRSQPPLLTQMVRIYVEHTNDTSILERAVPVLKKEWEWWITNRTVEVTTDGKTYS
LQRYHVNNNQPRPESYREDYITANNNSYYSTSGIIYPETTPLNDTQKALLYANLASGAES
GWDYSSRWLKNPNDAARDVYFPLRSLNVLDIVPVDLNSILYQNEVTIGKFLAQQGNKDEA
EEWAKKAEQRSEAMYKLMWNSTLWSYFDYNLTSSSQNIYVPADPQVFPFEKPSGTPEGSQ
ILFSVNQMFPFWTGAAPNQLKANPLAVKLAFERVKNLLDNKAGGIPATNFVTGQQWDEPN
VWPPLMHVLMDGLLNTPATFGEDDPAYQETQNLALRLAQRYVDSTFCTWYATGGSTSETP
KLQGLGPDAKGIMFEKYSDNSTNVAGSGGEYEVVEGFGWTNGVLIWAADKFGDKLKRPDC
GDITPAHVGKRADITVEKRAVELDAFDAKFTKKFAREGKLEKLKAKFRRHAAN

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	26	589	3e-156	0.9674134419551935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	7.56e-129	46	592	39	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	2.30e-118	23	592	36	545	alpha,alpha-trehalase
224541	TreA	7.02e-82	98	597	138	558	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	2.14e-72	97	583	126	528	alpha,alpha-trehalase TreA.
183936	treA	5.72e-72	97	592	127	537	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA35900.1|GH37	0.0	1	652	1	691
AEO70020.1|GH37	0.0	23	636	61	678
CAP59879.1|GH37	0.0	23	634	68	700
CDP22522.1|GH37	0.0	23	634	68	700
AEO53147.1|GH37	0.0	23	636	60	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	7.15e-67	49	592	79	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	9.94e-66	49	592	79	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	6.06e-61	92	589	87	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	3.98e-60	92	599	124	547	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	5.72e-58	92	589	87	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	3.97e-112	23	600	78	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	6.53e-100	30	595	61	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	4.10e-95	30	595	64	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	5.04e-95	30	595	64	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	8.93e-95	27	599	74	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999730	CS pos: 22-23. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_23402T0-p1.