CAZyme Information: NEUDI_19603T0-p1

Basic Information

• Species: Neurospora discreta
• Lineage: Ascomycota; Sordariomycetes; ; Sordariaceae; Neurospora; Neurospora discreta
• CAZyme ID: NEUDI_19603T0-p1
• CAZy Family: GH43
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		50958.50	4.6799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_NdiscretaFGSC8579	10345	510953	397	9948

• Gene Location: location=NdisFGSC8579_SC013:412402-414275(+)

Full Sequence      

MKAYLEYLVAALPLLGLATAQQVGKQTTETHPKLSWKKCTGKANCNTVSAEVVIDSNWRW
LHDSSGKNCYDGNKWTDACSSATDCASKCQLDGANYGTTYGASTSGDALTLKFVTKHDYG
TNIGSRFYLMNGASKYQMFTLMNNEFAFDVDLSTVECGLNAALYFVAMEEDGGMASYSSN
KAGAKYGTGYCDAQCARDLKFVGGKANVEGWAPSTNDANAGVGPYGGCCAEIDIWESNAH
SFAFTPHACKTNKYHVCEKDNCGGTYSEDRFAGVCDANGCDYNPYRMGNTDFYGKGKTVD
TSKKFTVVSRFEENKLSQFFVQNGKKIEIPSPKWDGIPSDSANITPELCAAQFQAFGDRD
RFAEVGGFAQLNSALRMPMVLVMSIWDDHYANMLWLDSVYPPEKEGQPGAARGDCPQSSG
VPAEVESQYASSKVVGAGARMQEGGEGHAWDDARISDLDGWSSENEDLVS

Enzyme Prediction     

EC	3.2.1.176:83	3.2.1.132:6	3.2.1.4:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH7	22	435	6.3e-165	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
153432	GH7_CBH_EG	0.0	29	435	2	379	Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
395677	Glyco_hydro_7	0.0	23	435	1	422	Glycosyl hydrolase family 7.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD70429.1|GH7	0.0	1	441	1	441
CAD79794.1|GH7	1.38e-277	1	441	2	441
CAD79785.1|GH7|3.2.1.176	2.60e-271	1	441	3	443
ABN13116.1|GH7|3.2.1.176	2.39e-269	2	441	4	442
AAU96164.1|GH7|3.2.1.176	7.10e-269	1	441	3	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RFW_A	1.99e-259	22	441	2	421	Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces [Melanocarpus albomyces],2RFW_B Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces [Melanocarpus albomyces],2RFW_C Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces [Melanocarpus albomyces],2RFW_D Crystal Structure of Cellobiohydrolase from Melanocarpus albomyces [Melanocarpus albomyces],2RFY_A Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellobiose [Melanocarpus albomyces],2RFY_B Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellobiose [Melanocarpus albomyces],2RFY_C Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellobiose [Melanocarpus albomyces],2RFY_D Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellobiose [Melanocarpus albomyces],2RFZ_A Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotriose [Melanocarpus albomyces],2RFZ_B Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotriose [Melanocarpus albomyces],2RFZ_C Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotriose [Melanocarpus albomyces],2RFZ_D Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotriose [Melanocarpus albomyces],2RG0_A Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotetraose [Melanocarpus albomyces],2RG0_B Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotetraose [Melanocarpus albomyces],2RG0_C Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotetraose [Melanocarpus albomyces],2RG0_D Crystal structure of cellobiohydrolase from Melanocarpus albomyces complexed with cellotetraose [Melanocarpus albomyces]
5W11_A	2.13e-178	27	441	7	427	Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus],5W11_B Biochemical and structural insights into the catalytic mechanism of thermostable cellobiohydrolase Cel7A from industrially relevant fungus Myceliophthora thermophila [Thermothelomyces thermophilus]
4CSI_A	8.31e-178	27	441	7	427	Chain A, CELLULASE [[Humicola] grisea var. thermoidea],4CSI_B Chain B, CELLULASE [[Humicola] grisea var. thermoidea]
1Q9H_A	2.77e-168	22	434	2	420	Chain A, cellobiohydrolase I catalytic domain [Rasamsonia emersonii],3PFJ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFX_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PFZ_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii],3PL3_A Chain A, Cellobiohydrolase 1 catalytic domain [Rasamsonia emersonii]
4V1Z_A	8.78e-163	22	435	2	424	The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus [Aspergillus fumigatus],4V20_A The 3-D structure of the cellobiohydrolase, Cel7A, from Aspergillus fumigatus, disaccharide complex [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SA23|GUX1A_NEUCR	1.90e-188	10	435	7	435	Exoglucanase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=cbh-1 PE=3 SV=1
sp|Q00548|GUX1_CRYPA	1.54e-180	14	435	12	439	Exoglucanase 1 OS=Cryphonectria parasitica OX=5116 GN=CBH-1 PE=3 SV=1
sp|P15828|GUX1_HUMGT	2.53e-177	14	441	12	445	Exoglucanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=CBH-1 PE=1 SV=2
sp|Q8WZJ4|XYNA_TALFU	5.71e-167	14	435	19	445	1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus OX=28572 GN=xynA PE=1 SV=1
sp|A1DNL0|CBHB_NEOFI	3.86e-165	14	435	20	450	Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=cbhB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999757	CS pos: 20-21. Pr: 0.9760

TMHMM  Annotations     

There is no transmembrane helices in NEUDI_19603T0-p1.